HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html lo-1996-1 Interaction between hepatitis C virus core protein and E1 envelope protein. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lo S.Y., Selby M.J., Ou J.H. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1996 imex curation Only protein-protein interactions imex curation lo-1996-2 Interaction between hepatitis C virus core protein and E1 envelope protein. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Lo S.Y., Selby M.J., Ou J.H. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1996 imex curation Only protein-protein interactions imex curation p27958-pro_0000037569 Envelope glycoprotein E1 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) YQVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVDA 192 383 p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 p27958_pr-p27958_p-3 1430425 n/a E1 1430427 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a Core 1430428 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1,2 and 4 p27958_pr-p27958_p-4 1430426 n/a Core 1430428 unspecified role unspecified role neutral component neutral component tpa tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a E1 1430427 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3