MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lewis-1995-3 Adenovirus E1A proteins interact with the cellular YY1 transcription factor. unknown Unknown far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Lewis BA., Tullis G., Seto E., Horikoshi N., Weinmann R., Shenk T. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1995 rapid curation rapid curation lewis-1995-1 Adenovirus E1A proteins interact with the cellular YY1 transcription factor. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lewis BA., Tullis G., Seto E., Horikoshi N., Weinmann R., Shenk T. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1995 rapid curation rapid curation lewis-1995-4 Adenovirus E1A proteins interact with the cellular YY1 transcription factor. unknown Unknown pull down pull down predetermined predetermined participant predetermined Lewis BA., Tullis G., Seto E., Horikoshi N., Weinmann R., Shenk T. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1995 rapid curation rapid curation lewis-1995-2 Adenovirus E1A proteins interact with the cellular YY1 transcription factor. unknown Unknown density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Lewis BA., Tullis G., Seto E., Horikoshi N., Weinmann R., Shenk T. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1995 rapid curation rapid curation e1a_ade12 Early E1A protein Early E1A 29.5 kDa protein protein protein ade12 Human adenovirus A serotype 12 (HAdV-12) Human adenovirus 12 MRTEMTPLVLSYQEADDILEHLVDNFFNEVPSDDDLYVPSLYELYDLDVESAGEDNNEQAVNEFFPESLILAASEGLFLPEPPVLSPVCEPIGGECMPQLHPEDMDLLCYEMGFPCSDSEDEQDENGMAHVSASAAAAAADREREEFQLDHPELPGHNCKSCEHHRNSTGNTDLMCSLCYLRAYNMFIYSPVSDNEPEPNSTLDGDERPSPPKLGSAVPEGVIKPVPQRVTGRRRCAVESILDLIQEEEREQTVPVDLSVKRPRCN E1A protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1 by direct competition for the same binding site on RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. The tumorigenesis-restraining activity of E1A may be related to the disruption of the host CtBP-CtIP complex through the CtBP binding motif mint tyy1_human Transcriptional repressor protein YY1 Yin and yang 1 Delta transcription factor NF-E1 YY1 INO80S INO80 complex subunit S protein protein human Homo sapiens Human MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ q8jsk4_ade03 Early E1A protein E1A protein protein hadv-3 Human adenovirus B serotype 3 HAdV-3 Human adenovirus 3 MRHLRFLPQEVISSETGIEILEFVVNTLMGDDPEPPVQPFDPPTLHDLYDLEIDGPEDPNEEAVNGFFTDSMLLAADEGLDINPPPETLVTPGVVVESGIGGKKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPGHGCKSCEFHRNNTGMKELLCSLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPAPANVCKPIPVKPKPGKRPAVDKLEDLLEGGDGPLDLSTRKLPRQ mint rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK tbp_human TATA-box-binding protein TBP TF2D TFIID GTF2D1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription initiation factor TFIID TBP subunit protein protein human Homo sapiens Human MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT e1a-yy1-3 745035 e1a_ade12 745039 unspecified role unspecified role neutral component neutral component tyy1_human 745040 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3 homomint mint e1a-yy1-4 745035 q8jsk4_ade03 745041 unspecified role unspecified role neutral component neutral component tyy1_human 745040 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3 homomint mint e1a-rb1-7 745035 q8jsk4_ade03 745041 unspecified role unspecified role neutral component neutral component rb_human 745042 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3 homomint mint e1a-tbp-2 745035 q8jsk4_ade03 745041 unspecified role unspecified role neutral component neutral component tbp_human 745043 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3 homomint mint e1a-yy1 745036 e1a_ade12 745039 unspecified role unspecified role neutral component neutral component tyy1_human 745040 unspecified role unspecified role neutral component neutral component physical association physical association false false false F1 homomint mint e1a-yy1-1 745036 q8jsk4_ade03 745041 unspecified role unspecified role neutral component neutral component tyy1_human 745040 unspecified role unspecified role neutral component neutral component physical association physical association false false false F1 homomint mint yy1-e1a 745037 e1a_ade12 745039 unspecified role unspecified role prey prey tyy1_human 745040 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F4 F5 F6 F7 homomint mint yy1-e1a-1 745037 q8jsk4_ade03 745041 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tyy1_human 745040 unspecified role unspecified role bait bait physical association physical association false false false F4 F5 F6 F7 homomint mint e1a-yy1-2 745038 q8jsk4_ade03 745041 unspecified role unspecified role neutral component neutral component tyy1_human 745040 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F2 homomint mint