MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint finley-1994-1 Interaction mating reveals binary and ternary connections between Drosophila cell cycle regulators. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Finley RL., Brent R. Virus - Publications including interactions involving viral proteins Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1994 cdk1_yeast Cyclin-dependent kinase 1 CDC28 CDK1 HSL5 SRM5 YBR1211 YBR160W Cell division control protein 28 Cell division protein kinase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES 57A7A2B97A90DC6C q24159_drome CycJ CG10308 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly FNFDTMEQKVAAEQNIFVVDRKLKKTCPQADVERLAKTHWLTDYARDIFLTMREQELSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRLALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERIHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEAHVEPYMNVLTDYHYYHVIQADYGSPSVQTNQSLASPDSGFEESFTENTNLVVSDEVVTVETYNIITVQLQDPSPHSSTFLPKEQTNLKRSRFEDDTENQHPLKHAKVESVAKD cks1_drome Cyclin-dependent kinases regulatory subunit Cks30A CDI2 Cks CG3738 Cks1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILLFRRPKTD q24158_drome CycD CG9096 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly QMSSPAIIRDQSSICSSLGDAESDSHPDAQNNAVVCNMKELVYIYASVDSAAKNPEQLEPPPPPPPPPPPPPTATQSIQSYPRYISQEPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFFLSLMTDLTSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLPLPKAPAECVEQHQQQHNFGSAAPHRTHTCKMQAQAQAQNEIQDVTF cdk3_human Cyclin-dependent kinase 3 CDK3 Cell division protein kinase 3 CDKN3 protein protein human Homo sapiens Human MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH p91654_drome dap dacapo CG1772 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly QGSPAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELERHQELATQKWGFDFRAGCPLAEKSPYIWERVSFQESSFAPEMYTLTRAAHVRPSVDASRSDMDILVNERSERENFGSNLVNSSLESNTDNESCYDSQDESLTMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQAPKKLSPAKAMRPVLPVRPPLPAPAPAWIWVGGTLWGDVEAAAPQLMLQIRWPTHRIAICNFIFYKPLRLCSIS cdk1_drome Cyclin-dependent kinase 1 Cdk1 Cell division control protein 2 homolog Cell division protein kinase 1 cdc2 p34 protein kinase CG5363 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQSGLVRN ccne_drome G1/S-specific cyclin-E CycE CG3938 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGLNAKSVCSTSSTEPNGSIVTTAPSNGEVSSSIVVVVSSSSISSSSDSPIAILPHPDPIPSTSFSSASQRSEEELPGTSAASRTDEMCSCDSQNLAASTAATSNGNKRKRRLSSDSNEDPELGFEPPSAKRQQRLPALYGSEQGNLSSVASSVYTSPVVSVDGQSTQELLSIRSSPAEDLSEAPHSPLPDSPDSPPSPDRGSKQTPVVVRYAAEQVVTSTVVTQKTEDDDLLDDSCEDYSYDEDDEDDVEEEDDDVEIYSSTISPASSGCSQQQAVNGERTPGLPKHQEQIHHPVSDLMINMRTPMSPAVENGLRQCPLPALAWANAADVWRLMCHRDEQDSRLRSISMLEQHPGLQPRMRAILLDWLIEVCEVYKLHRETFYLAVDYLDRYLHVAHKVQKTHLQLIGITCLFVAAKVEEIYPPKIGEFAYVTDGACTERDILNHEKILLQALDWDISPITITGWLGVYMQLNVNNRTPASFSQIGRQKSAEADDAFIYPQFSGFEFVQTSQLLDLCTLDVGMANYSYSVLAAAAISHTFSREMALRCSGLDWQVIQPCARWMEPFFRVISQKAPYLQLNEQNEQVSNKFGLGLICPNIVTDDSHIIQTHTTTMDMYDEVLMAQDAAHAMRARIQASPATALRAPESLLTPPASSHKPDEYLGDEGDETGARSGISSTTTCCNTAASNKGGKSSSNNSVTSCSSRSNP cdk2_drome Cyclin-dependent kinase 2 Cdk2 Cell division control protein 2 cognate cdc2c CG10498 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTTILDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQLFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYFRNVQHVDHVALPVDPNAGSASRLTRLV cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM cycj-cdc28 3611 cdc28_yeast 3612 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q24159_drome 3613 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cks30a-cdc28 3611 cks1_drome 3614 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc28_yeast 3612 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint cycd-cdc28 3611 cdc28_yeast 3612 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q24158_drome 3615 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cks30a-cdk3 3611 cks1_drome 3614 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdk3_human 3616 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint dap-cdk3 3611 p91654_drome 3617 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdk3_human 3616 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint cycd-cdk3 3611 cdk3_human 3616 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q24158_drome 3615 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cks30a-cdc2-1 3611 cks1_drome 3614 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc2_drome 3618 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint cyce-cdc2-1 3611 cdc2_drome 3618 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 ccne_drome 3619 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cycd-cdc2-1 3611 cdc2_drome 3618 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q24158_drome 3615 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cycj-cdc2c 3611 q24159_drome 3613 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc2c_drome 3620 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cks30a-cdc2c 3611 cdc2c_drome 3620 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cks1_drome 3614 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint dap-cdc2c 3611 cdc2c_drome 3620 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 p91654_drome 3617 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint cycd-cdc2c 3611 q24158_drome 3615 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cdc2c_drome 3620 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cycd-cdk4 3611 cdk4_human 3621 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q24158_drome 3615 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint cks30a-cdk1 3611 cdk1_human 3622 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cks1_drome 3614 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint cks30a-cycj-1 3611 q24159_drome 3613 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cks1_drome 3614 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint