IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ conti-2020-1 in vitro In vitro enzymatic study enzymatic study weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins Nucleotidyl-monophosphate transferase activity-NMPylation;protein guanylylation. EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus conti-2020-2 in vitro In vitro enzymatic study enzymatic study sequence tag sequence tag identification sequence tag Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins Nucleotidyl-monophosphate transferase activity-NMPylation;protein guanylylation. The assays were carried out in the presence of nucleotides : GTP, or 15N-GTP, or 13C-GTP. EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus conti-2020-3 in vitro In vitro uridylation assay uridylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus conti-2020-4 in vitro In vitro uridylation assay uridylation assay sequence tag sequence tag identification sequence tag Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus p19811-pro_0000036626 RNA-directed RNA polymerase rep ORF1ab polyprotein 1a-1b protein protein EAV Equine arteritis virus (strain Bucyrus) GLDQDKVLDLTNMLKVDPTELSSKDKAKARQLAHLLLDLANPVEAVNQLNLRAPHIFPGDVGRRTFADSKDKGFVALHSRTMFLAARDFLFNIKFVCDEEFTKTPKDTLLGYVRACPGYWFIFRRTHRSLIDAYWDSMECVYALPTISDFDVSPGDVAVTGERWDFESPGGGRAKRLTADLVHAFQGFHGASYSYDDKVAAAVSGDPYRSDGVLYNTRWGNIPYSVPTNALEATACYRAGCEAVTDGTNVIATIGPFPEQQPIPDIPKSVLDNCADISCDAFIAPAAETALCGDLEKYNLSTQGFVLPSVFSMVRAYLKEEIGDAPPLYLPSTVPSKNSQAGINGAEFPTKSLQSYCLIDDMVSQSMKSNLQTATMATCKRQYCSKYKIRSILGTNNYIGLGLRACLSGVTAAFQKAGKDGSPIYLGKSKFDPIPAPDKYCLETDLESCDRSTPALVRWFATNLIFELAGQPELVHSYVLNCCHDLVVAGSVAFTKRGGLSSGDPITSISNTIYSLVLYTQHMLLCGLEGYFPEIAEKYLDGSLELRDMFKYVRVYIYSDDVVLTTPNQHYAASFDRWVPHLQALLGFKVDPKKTVNTSSPSFLGCRFKQVDGKCYLASLQDRVTRSLLYHIGAKNPSEYYEAAVSIFKDSIICCDEDWWTDLHRRISGAARTDGVEFPTIEMLTSFRTKQYE 1678 2370 rpoa_eavbu Replicase polyprotein 1ab rep 1a-1b ORF1ab polyprotein protein protein EAV Equine arteritis virus (strain Bucyrus) MATFSATGFGGSFVRDWSLDLPDACEHGAGLCCEVDGSTLCAECFRGCEGMEQCPGLFMGLLKLASPVPVGHKFLIGWYRAAKVTGRYNFLELLQHPAFAQLRVVDARLAIEEASVFISTDHASAKRFPGARFALTPVYANAWVVSPAANSLIVTTDQEQDGFCWLKLLPPDRREAGLRLYYNHYREQRTGWLSKTGLRLWLGDLGLGINASSGGLKFHIMRGSPQRAWHITTRSCKLKSYYVCDISEADWSCLPAGNYGGYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAYRVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAATFGNVRVVTPEGQPRPVPAPRVRPSANSSGDVKDPAPVPPVPKPRTKLATPNPTQAPIPAPRTRLQGASTQEPLASAGVASDSAPKWRVAKTVYSSAERFRTELVQRARSVGDVLVQALPLKTPAVQRYTMTLKMMRSRFSWHCDVWYPLAVIACLLPIWPSLALLLSFAIGLIPSVGNNVVLTALLVSSANYVASMDHQCEGAACLALLEEEHYYRAVRWRPITGALSLVLNLLGQVGYVARSTFDAAYVPCTVFDLCSFAILYLCRNRCWRCFGRCVRVGPATHVLGSTGQRVSKLALIDLCDHFSKPTIDVVGMATGWSGCYTGTAAMERQCASTVDPHSFDQKKAGATVYLTPPVNSGSALQCLNVMWKRPIGSTVLGEQTGAVVTAVKSISFSPPCCVSTTLPTRPGVTVVDHALYNRLTASGVDPALLRVGQGDFLKLNPGFRLIGGWIYGICYFVLVVVSTFTCLPIKCGIGTRDPFCRRVFSVPVTKTQEHCHAGMCASAEGISLDSLGLTQLQSYWIAAVTSGLVILLVCHRLAISALDLLTLASPLVLLVFPWASVGLLLACSLAGAAVKIQLLATLFVNLFFPQATLVTMGYWACVAALAVYSLMGLRVKVNVPMCVTPAHFLLLARSAGQSREQMLRVSAAAPTNSLLGVARDCYVTGTTRLYIPKEGGMVFEGLFRSPKARGNVGFVAGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTSIPKDIPDNIIADVDAVPRSLAMLIDGLSNRESSLSGPQLLLIACFMWSYLNQPAYLPYVLGFFAANFFLPKSVGRPVVTGLLWLCCLFTPLSMRLCLFHLVCATVTGNVISLWFYITAAGTSYLSEMWFGGYPTMLFVPRFLVYQFPGWAIGTVLAVCSITMLAAALGHTLLLDVFSASGRFDRTFMMKYFLEGGVKESVTASVTRAYGKPITQESLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEEANDTPVKPMPSRRRRKGLPKGAQLEWDRHQEEKRNAGDDDFAVSNDYVKRVPKYWDPSDTRGTTVKIAGTTYQKVVDYSGNVHYVEHQEDLLDYVLGKGSYEGLDQDKVLDLTNMLKVDPTELSSKDKAKARQLAHLLLDLANPVEAVNQLNLRAPHIFPGDVGRRTFADSKDKGFVALHSRTMFLAARDFLFNIKFVCDEEFTKTPKDTLLGYVRACPGYWFIFRRTHRSLIDAYWDSMECVYALPTISDFDVSPGDVAVTGERWDFESPGGGRAKRLTADLVHAFQGFHGASYSYDDKVAAAVSGDPYRSDGVLYNTRWGNIPYSVPTNALEATACYRAGCEAVTDGTNVIATIGPFPEQQPIPDIPKSVLDNCADISCDAFIAPAAETALCGDLEKYNLSTQGFVLPSVFSMVRAYLKEEIGDAPPLYLPSTVPSKNSQAGINGAEFPTKSLQSYCLIDDMVSQSMKSNLQTATMATCKRQYCSKYKIRSILGTNNYIGLGLRACLSGVTAAFQKAGKDGSPIYLGKSKFDPIPAPDKYCLETDLESCDRSTPALVRWFATNLIFELAGQPELVHSYVLNCCHDLVVAGSVAFTKRGGLSSGDPITSISNTIYSLVLYTQHMLLCGLEGYFPEIAEKYLDGSLELRDMFKYVRVYIYSDDVVLTTPNQHYAASFDRWVPHLQALLGFKVDPKKTVNTSSPSFLGCRFKQVDGKCYLASLQDRVTRSLLYHIGAKNPSEYYEAAVSIFKDSIICCDEDWWTDLHRRISGAARTDGVEFPTIEMLTSFRTKQYESAVCTVCGAAPVAKSACGGWFCGNCVPYHAGHCHTTSLFANCGHDIMYRSTYCTMCEGSPKQMVPKVPHPILDHLLCHIDYGSKEELTLVVADGRTTSPPGRYKVGHKVVAVVADVGGNIVFGCGPGSHIAVPLQDTLKGVVVNKALKNAAASEYVEGPPGSGKTFHLVKDVLAVVGSATLVVPTHASMLDCINKLKQAGADPYFVVPKYTVLDFPRPGSGNITVRLPQVGTSEGETFVDEVAYFSPVDLARILTQGRVKGYGDLNQLGCVGPASVPRNLWLRHFVSLEPLRVCHRFGAAVCDLIKGIYPYYEPAPHTTKVVFVPNPDFEKGVVITAYHKDRGLGHRTIDSIQGCTFPVVTLRLPTPQSLTRPRAVVAVTRASQELYIYDPFDQLSGLLKFTKEAEAQDLIHGPPTACHLGQEIDLWSNEGLEYYKEVNLLYTHVPIKDGVIHSYPNCGPACGWEKQSNKISCLPRVAQNLGYHYSPDLPGFCPIPKELAEHWPVVSNDRYPNCLQITLQQVCELSKPCSAGYMVGQSVFVQTPGVTSYWLTEWVDGKARALPDSLFSSGRFETNSRAFLDEAEEKFAAAHPHACLGEINKSTVGGSHFIFSQYLPPLLPADAVALVGASLAGKAAKAACSVVDVYAPSFEPYLHPETLSRVYKIMIDFKPCRLMVWRNATFYVQEGVDAVTSALAAVSKLIKVPANEPVSFHVASGYRTNALVAPQAKISIGAYAAEWALSTEPPPAGYAIVRRYIVKRLLSSTEVFLCRRGVVSSTSVQTICALEGCKPLFNFLQIGSVIGPV p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 rep-270 4079071 N/A 4079075 putative self putative self putative self putative self purified purified P19811-PRO_0000036626:p.Lys380Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false true false 1A, Supp. figure 12 A weak band only, is visible. Addition of nsp7 resulted in higher levels of radionucleotide incorporation into both Nsp7 and Nsp9. Nsp7 rep-271 4079071 N/A 4079076 enzyme target enzyme target substrate substrate neutral component neutral component nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079075 enzyme enzyme neutral component neutral component purified purified P19811-PRO_0000036626:p.Lys380Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 1A, 5 B/C, Supp. figure 12 In competition experiments GTP outcompeted UTP, whereas adenosine triphosphate (ATP) and cytidine triphosphate (CTP) did not compete. rep-rep-270 4079071 N/A 4079077 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 1B rep-rep-271 4079071 N/A 4079079 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 1B rep-rep-272 4079071 N/A 4079077 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079079 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P0DTD1-PRO_0000449629:p.Arg116Lys mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false P0DTD1-PRO_0000449629:p.Arg116Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 1 B/C, 5 B/C In competition experiments GTP outcompeted UTP, whereas adenosine triphosphate (ATP) and cytidine triphosphate (CTP) did not compete. rep-rep-275 4079071 N/A 4079077 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P0DTD1-PRO_0000449625:p.Ser1_Lys2delinsAlaAla mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false P0DTD1-PRO_0000449625:p.Lys2Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0DTD1-PRO_0000449625:p.Ser1Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4079079 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false 4 A/B rep-rep-280 4079071 N/A 4079076 enzyme target enzyme target substrate substrate neutral component neutral component P19811:p.Lys1595Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P19811:p.Thr1455Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P19811:p.Lys1608Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P19811:p.Lys1624Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4079075 enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Supp. figure 12 rep-rep-273 4079072 N/A 4079077 enzyme target enzyme target substrate substrate neutral component neutral component purified purified lys2 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false P0DTD1-PRO_0000449625:p.Ser1Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0DTD1-PRO_0000449625:p.Ser1_Lys2delinsAlaAla mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false ser1 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false P0DTD1-PRO_0000449625:p.Lys2Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Table 1, Figure 4C, Supp. figure 6/7/8 The data indicates that lysine-2 is the preferred acceptor site for GMP. The modification site (Ser1) was not confirmed by Alanine mutation. rep-rep-274 4079072 N/A 4079076 enzyme target enzyme target substrate substrate neutral component neutral component P19811:p.Thr1455Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false lys1595 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false P19811:p.Lys1595Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false P19811:p.Lys1608Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false lys1608 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false lys1624 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false P19811:p.Lys1624Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false thr 1455 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4079075 enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Table 1, Supp. figure 11 rep-275 4079072 N/A 4079075 putative self putative self putative self putative self purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lys380 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain false P19811-PRO_0000036626:p.Lys380Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false true false Table 1, Supp. figure 11 rep-276 4079073 N/A 4079075 putative self putative self putative self putative self purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation false true false 5A rep-rep-276 4079073 N/A 4079076 enzyme target enzyme target substrate substrate neutral component neutral component nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079075 enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation false false false 5A rep-rep-277 4079073 N/A 4079077 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079079 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation false false false 5A rep-rep-281 4079074 N/A 4079077 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ser1 uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4079078 sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation false false false 5 D/E, Supp. Table 6