IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mandala-2020-1 in vitro In vitro solid state nmr solid state nmr ssnmr solid state nmr predetermined predetermined participant predetermined Mandala VS., McKay MJ., Shcherbakov AA., Dregni AJ., Kolocouris A., Hong M. Virus - Publications including interactions involving viral proteins SARS-CoV-2 virus, envelope protein E transmembrane domain (ETM) was reconstituted in phospholipid bilayers. meihong@mit.edu Nature structural & molecular biology 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus vemp_sars2 Envelope small membrane protein E 4 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV 5-(n,n-hexamethylene)amiloride 5-(N,N-hexamethylene)amiloride HMA small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) amantadine amantadine 1-adamantanamine 1-adamantylamine 1-aminoadamantane amantadina amantadine Amantadine amantadinum Amantidine Aminoadamantane tricyclo[3.3.1.1(3,7)]decan-1-amine tricyclo[3.3.1.1(3,7)]decan-1-ylamine tricyclo[3.3.1.1(3,7)]decane-1-amine Viregyt Virosol adamantan-1-ylamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) DKNWSYNQZKUICI-UHFFFAOYSA-N e-1 3948774 N/A 3948775 unspecified role unspecified role neutral component neutral component purified purified transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 direct interaction direct interaction false false false 2D, Table 1, supp. Tables 1+2. e-e-3 3948774 N/A 3948775 unspecified role unspecified role neutral component neutral component purified purified transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 4'-19fluoro-L-phenylalanine isotope label isotope label certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3948775 unspecified role unspecified role neutral component neutral component purified purified transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2, Extended Data 5, supp. Table 3 An equimolar mixture of 13C-labeled protein and 4-19F-Phe-labeled protein was used to measure intermolecular 13C-19F distances using the rotational-echo double-resonance (REDOR) technique. A single pentamer model, characterized by having Asn15 and Val25 at similar pore-facing orientations and all three Phe residues facing lipids, was found to best describe the experimental data. 5_(n,n_hexamethylene)amiloride-e-1 3948774 N/A 3948776 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3948775 unspecified role unspecified role neutral component neutral component purified purified transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4 The CSPs (Chemical Shift Perturbations) of HMA are larger than those of AMT. amantadine-e-1 3948774 N/A 3948777 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3948775 unspecified role unspecified role neutral component neutral component purified purified transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4C, Extended Data Fig. 10 amantadine-e-2 3948774 N/A 3948777 unspecified role unspecified role neutral component neutral component 3-19Fluorine isotope label isotope label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3948775 unspecified role unspecified role neutral component neutral component purified purified transmembrane domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Extended Data Fig. 10