IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lin-2020-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus lin-2020-3 in vitro In vitro thermal shift thermal shift binding thermal shift predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus lin-2020-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus lin-2020-2 ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus lin-2020-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lin S., Chen H., Ye F., Chen Z., Yang F., Zheng Y., Cao Y., Qiao J., Yang S., Lu G. Virus - Publications including interactions involving viral proteins lugw@scu.edu.cn Signal transduction and targeted therapy 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449628 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ 4254 4392 p0dtd1-pro_0000449633 2'-O-methyltransferase nsp16 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 6799 7096 sinefungin sinefungin (2S,5S)-2,5-diamino-6-[(2R,3S,R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]hexanoic acid 6,9-Diamino-1-(6-amino-9H-purin-9-yl)-1,5,6,7,8,9-hexadeoxy-beta-D-ribo-decofuranuronic acid 6,9-Diamino-1-(6-amino-9H-purin-9-yl)-1,5,6,7,8,9-hexadeoxydecofuranuronic acid A 9145 ADENOSYL-ORNITHINE Antibiotic A 9145 sinefungin sinefungina sinefungine sinefunginum (5S)-5-amino-6-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]-L-norleucine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) LMXOHSDXUQEUSF-YECHIGJVSA-N (n(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rep-rep-101 3728369 N/A 3728374 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false 3728369 Figure 1 H/J The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). Stoichiometry was determined to be ~1.0uM with the refolded protein, and ~0.3uM with the protein purified directly from E. coli. rep-rep-103 3728369 N/A 3728377 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false 3728369 Figure 1 I/K The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). Stoichiometry was determined to be ~1.0uM with the refolded protein, and ~0.3uM with the protein purified directly from E. coli. rep-rep-106 3728369 N/A 3728378 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449628:p.Tyr30Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449633:p.Lys137Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false 3728369 Figure S4 B/C The protein-complex purified directly from E. coli -"co-expression". rep-rep-102 3728370 N/A 3728374 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 1 F/G The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). There was a shift in melting-temperature with the addition of SAM. rep-rep-104 3728370 N/A 3728377 unspecified role unspecified role neutral component neutral component cdna library cdna library chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 1 F/G The protein-complex with or without a denaturing-refolding cycle (to remove pre-bound SAM). There was a shift in melting-temperature with the addition of Sinefungin. rep-rep-100 3728371 N/A 3728374 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false Table S1 Results with and without additional SAM added during crystallization. rep-rep-99 3728372 N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449628:p.Tyr30Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified P0DTD1-PRO_0000449633:p.Lys137Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 direct interaction direct interaction false false false Figure S1 A/C The protein-complex purified directly from E. coli -"co-expression". Stoichiometry based on molecular weight. rep-rep-105 3728373 N/A 3728375 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3728376 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false Figure S1 B The protein-complex after the denaturing-refolding cycle. Stoichiometry based on molecular weight.