MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint yang-2018-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Yang F., Lei Y., Zhou M., Yao Q., Han Y., Wu X., Zhong W., Zhu C., Xu W., Tao R., Chen X., Lin D., Rahman K., Tyagi R., Habib Z., Xiao S., Wang D., Yu Y., Chen H., Fu Z., Cao G. Virus - Publications including interactions involving viral proteins The 15 interaction between Calpain and Mycobacterium tuberculosis proteins were not included because it is not specified which calpain is. To establish a high-throughput system which allows simultaneous PPI screening between a bait library and a prey library, the bait and prey vectors of the conventional Y2H system from Clontech were modified to develop a novel recombination-based ‘library versus library’ Y2H system, designated RLL-Y2H (Figure (Figure1).1). The design of this system is based on the high efficient DNA integration ability of PhiC31 as well as its specific recognition sites, ATTB and ATTP (22,23). Basically, ATTB and ATTP sites were fused right behind the bait and prey genes, respectively. In the presence of PhiC31 integrase, the bait and prey plasmids will be irreversibly integrated into a single plasmid, in which the bait and prey genes are fused at tail-to-tail orientation with an ATTL linker in between (designated bait-ATTL-prey) gcao@mail.hzau.edu.cn Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation yang-2018-9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Yang F., Lei Y., Zhou M., Yao Q., Han Y., Wu X., Zhong W., Zhu C., Xu W., Tao R., Chen X., Lin D., Rahman K., Tyagi R., Habib Z., Xiao S., Wang D., Yu Y., Chen H., Fu Z., Cao G. Virus - Publications including interactions involving viral proteins gcao@mail.hzau.edu.cn Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation y2280_myctu Uncharacterized FAD-linked oxidoreductase Rv2280 Rv2280 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSEMTARFSEIVGNANLLTGDAIPEDYAHDEELTGPPQKPAYAAKPATPEEVAQLLKAASENGVPVTARGSGCGLSGAARPVEGGLLISFDRMNKVLEVDTANQVAVVQPGVALTDLDAATADTGLRYTVYPGELSSSVGGNVGTNAGGMRAVKYGVARHNVLGLQAVLPTGEIIRTGGRMAKVSTGYDLTQLIIGSEGTLALVTEVIVKLHPRLDHNASVLAPFADFDQVMAAVPKILASGLAPDILEYIDNTSMAALISTQNLELGIPDQIRDSCEAYLLVALENRIADRLFEDIQTVGEMLMELGAVDAYVLEGGSARKLIEAREKAFWAAKALGADDIIDTVVPRASMPKFLSTARGLAAAADGAAVGCGHAGDGNVHMAIACKDPEKKKKLMTDIFALAMELGGAISGEHGVGRAKTGYFLELEDPVKISLMRRIKQSFDPAGILNPGVVFGDT bakor_mouse Beclin 1-associated autophagy-related key regulator Atg14 D14Ertd436e Kiaa0831 Autophagy-related protein 14-like protein Atg14L protein protein mouse Mus musculus Mouse MASPSGKGSWTPEAPGFGPRALARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSQLKNKQEEFQKEVLKAMEGKRLTDQLRWKIMSCKMRIEQLKQTICKGNEEMKKNSEGLLKNKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLKSHYERLARLRRSHILELTSIIFPIDEVKTSGRDPADVSSETDSAMTSSMVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYNWVEEKKTTQGPDMEHNNPAYTISAALGYATQLVNIVSHILDINLPKKLCNSEFCGENLSKQKLTRAVRKLNANILYLCSSQHVNLDQLQPLHTLRNLMHLVSPRSEHLGRSGPFEVRADLEESMEFVDPGVAGESDASGDERVSDEETDLGTDWENLPSPRFCDIPSQPVEVSQSQSTQVSPPIASSSAGGMISSAAASVTSWFKAYTGHR o07422_myctu Rv0178 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDERGAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPYLSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIAAANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKRYDARWLVTRMTTITSLDLTPQV p71619_myctu ugpB Rv2833c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSSAAERELIGRFQDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLLDDRWWFHFALSGVLTALDDLFGQVGVDTTDYVDSLLADYEFNGRHYAVPYARSTPLFYYNKAAWQQAGLPDRGPQSWSEFDEWGPELQRVVGAGRSAHGWANADLISWTFQGPNWAFGGAYSDKWTLTLTEPATIAAGNFYRNSIHGKGYAAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPDAAPACPTGGAGLAIPAKLSEERKVNALKFIAFVTNPTNTAYFSQQTGYLPVRKSAVDDASERHYLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLESIGLRGADVTKTFTNIQKRLQVILDRQIMRKLAGHG atg2a_mouse Autophagy-related protein 2 homolog A Atg2a Kiaa0404 protein protein mouse Mus musculus Mouse MSRWLWPWSNCVKERVCRYLLQHYLGHFFQEHLSLDQLSLDLYKGSVALRDIHLETWSVNEFLRSMESPLELVEGFVSSIEVAVPWAALLTDHCTVCVSGLQLTLQPRQGSGPGAADSQSWASCMTTSLQLAQECLREGLPEPSEPPQPLEGLEMFAQTIETVLRRIKVTFLNTVVRVEHSLGDEDRSVAVEVRVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLSGVCLYFEELPSQADPPQPPLQIGSCTGYVELMVRLKQNEAFPGPKLEVSGQLGSLHLLLTPRQLQQLQRLLSAVNLADPAGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAESLSLYPITNPLNLDSTDLFFSMAGLTSSVTSAVSELSVYSVDLGSSVHSNMAFHRPSTPPHSGGKMAPTPLLDTTRPDSLVKMTLGGVSLTLLQTASPSSGPSDLPTHFFAEFDAAKDGPFGSRDFSHLRPRFQRACPCSHVRLTGTAVQLSWELRTGSHSRRTSSTEVHFGQLEVLECLWPRAATEPEYTEILSFPSHSGSEASARPCAHLRHTQTIRRVLKSRSRRSTACHCHSELSLDLADFQSDVELGSLDRLAALFRQVTTPSEPPAGLLTEPPQATELQTVFRLSAPRATLRLRFPIPDLRPDRDPWAGQAVRAEQLRLELSEPQFRSELNSGPGPPAPTRLELTCSDLQGIYEDGEKPPVPCLRVSKALNPRSTEAKYFLPQVVVTLNPQSSGTQWETAYEKGRDLELSTESPCELQQPEPSPFSSKRTMYETEEMVIPGDPEEMRTFQSRTLALSRCTLDVIMPSAHIFLPSKEVYESIYNRINNDLLMWEPADLLPTSSAAARPPGSSGFKMCKSAFKLDSDSDEEDAQFFSMASGVPQTPAPEPSRRQSQSTFSTLVTVLKGRITALCEAKDETGKRLDVTHGELVLDVEQGTIFSVAQYRGQPGLGYFCLEAEKAKLYHRAAIEDYLLPTHLEVPSFAPPAQLAPTIYPSEEGVTERGTLGRKGQGPPMLSAAVRIHLDPHKNVKEFLVTVRLHKATLRHYMAPPEQSWHSQLLDFLDVLDDPVLGYLPPTVITVLHTHLFSCAVDYRPLYLPVRVLVTAETFTLSSNIVMDTSTFLLRFILDDSALYLSDKCEVESLDLRRDYVCVLDIDLLELVIKTWKGSTEGRLSQPLFELRCSNNVVHVHSCADSCALLVNLLQYLTSSGDLHPPPRPPSPTEIAGQKLSESPASLPSCLPVETALINQRDLTDALLDTERRGLQELAQSSGGPLPQASPVSVYLFPGERSGAQAPLPPPGASSHTLGSKAKEHENEEEGDGDTLDSDEFCILDAPGLGIAPRDGEPIVTQLHPGPIIVHDGHFSQPLGSTDLLRAPAHFPVPSSRVVLREVSFIWHLYGGRDFGLHPTYRARVGLTGPRVSPSRSSGPNRPQNSWRTQGGIGRQHQVLMEIQLSKVSFQHEVYPEESAIAGGLGQELDERPLSRQVLIVQELEIRDRLATSKINKFLHLHTSERLPRRTHSNMLTIKALHVAPTSSVGGPECCLRVSMMPLRLNVDQDALFFLKDFFTSLAASINPMVPGDTSEAPRETHSRPGSPQEGQSEDTETASNPPEAPGSSHSSSDQQPIYFREFRFTSEVPICLDYHGKHVTVDQVGTFMGLLIGLAQLNCSELKLKRLCCRHGLLGVDKVLCYALNEWLQDIRKNQLPGLLGGVGPMHSVVQLFQGFRDLLWLPIEQYRKDGRLIRGLQRGAASFGSSTASAALELSNRLVQAIQATAETVYDILSPASPVSRSLQDKRSSRKLRRGQQPADLREGMAKAYDAVREGILDTAQTICDVASRGHEQKGLTGAVGGVIRQLPPTVVKPIIVATEATSNVLGGMRNQILPDAHKDHALKWRLEEAQD gln1a_myctu Glutamine synthetase glnA2 Glutamate--ammonia ligase Glutamine synthetase I alpha MTCY190.33c MTCY427.03c Rv2222c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MDRQKEFVLRTLEERDIRFVRLWFTDVLGFLKSVAIAPAELEGAFEEGIGFDGSSIEGFARVSESDTVAHPDPSTFQVLPWATSSGHHHSARMFCDITMPDGSPSWADPRHVLRRQLTKAGELGFSCYVHPEIEFFLLKPGPEDGSVPVPVDNAGYFDQAVHDSALNFRRHAIDALEFMGISVEFSHHEGAPGQQEIDLRFADALSMADNVMTFRYVIKEVALEEGARASFMPKPFGQHPGSAMHTHMSLFEGDVNAFHSADDPLQLSEVGKSFIAGILEHACEISAVTNQWVNSYKRLVQGGEAPTAASWGAANRSALVRVPMYTPHKTSSRRVEVRSPDSACNPYLTFAVLLAAGLRGVEKGYVLGPQAEDNVWDLTPEERRAMGYRELPSSLDSALRAMEASELVAEALGEHVFDFFLRNKRTEWANYRSHVTPYELRTYLSL mak1_myctu Maltokinase mak Maltose-1-phosphate synthase Rv0127 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTRSDTLATKLPWSDWLSRQRWYAGRNRELATVKPGVVVALRHNLDLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLLSLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVSSGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGWAMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRMLARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAAFCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS esxo_myctu ESAT-6-like protein EsxO esxO MTCY98.15c Rv2346c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA espl_myctu ESX-1 secretion-associated protein EspL espL Rv3880c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSMDELDPHVARALTLAARFQSALDGTLNQMNNGSFRATDEAETVEVTINGHQWLTGLRIEDGLLKKLGAEAVAQRVNEALHNAQAAASAYNDAAGEQLTAALSAMSRAMNEGMA dcdb_myctu dCTP deaminase, dUMP-forming dcd Bifunctional dCTP deaminase:dUTPase DCD-DUT MTCY63.26 Rv0321 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYGSSRAGSKYQGQRGPTPSRSYQNFIRST i6y946_myctu Rv0925c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTTSDQNAAAPPRFDGLRALFINATLKRSPELSHTDGLIERSSGIMREHGVQVDTLRAVDHDIATGVWPDMTEHGWATDEWPALYRRVLDAHILVLCGPIWLGDNSSVMKRVIERLYACSSLLNEDGQYAYYGRAGGCLITGNEDGVKHCAMNVLYSLQHLGYTIPPQADAGWIGEAGPGPSYLDPGSGGPENDFTNRNTTFMTFNLMHIAQMLRVAGGIPAYGNQRTKWDAGCRPDFANPDYR chp2_myctu Diacyltrehalose acyltransferase Chp2 chp2 LH57_06500 P425_01234 Rv1184c RVBD_1184c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MKRVIAGAFAVWLVGWAGGFGTAIAASEPAYPWAPGPPPSPSPVGDASTAKVVYALGGARMPGIPWYEYTNQAGSQYFPNAKHDLIDYPAGAAFSWWPTMLLPPGSHQDNMTVGVAVKDGTNSLDNAIHHGTDPAAAVGLSQGSLVLDQEQARLANDPTAPAPDKLQFTTFGDPTGRHAFGASFLARIFPPGSHIPIPFIEYTMPQQVDSQYDTNHVVTAYDGFSDFPDRPDNLLAVANAAIGAAIAHTPIGFTGPGDVPPQNIRTTVNSRGATTTTYLVPVNHLPLTLPLRYLGMSDAEVDQIDSVLQPQIDAAYARNDNWFTRPVSVDPVRGLDPLTAPGSIVEGARGLLGSPAFGG o53319_myctu Rv3169 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPQMLGPLDEYPLHQLPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFLITGIGYYPNLGVKDAFVLIRRADIQTAVHLSDAIDSDRLHQHVNGYRVEVVEPLRKLRIVLDETEGVAADLTWEGLFDVVQEQPHVLRSGNRVTLDAQRFAQLGTWSGRIVVDGERIAVDPATWLGSRDRSWGIRPVGEPEPAGRPADPPFEGMWWLYVPLAFDDFAVVLIIQEEPDGFRSLNDCTRIWRDGHVEQLGWPRVRIHYRSGTRIPTGATIEASTPDGAPVHFDVESKLAVPTHVGGGYGGDSDWSHGMWKGEKFVERRTYDMTDPTIIARAGFGVIDHVGRALCRDGDGNPVQGWGLFEHGALGRHDPSGFADWSTLAP aspat_myctu Aspartate aminotransferase Rv3722c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSFDSLSPQELAALHARHQQDYAALQGMKLALDLTRGKPSAEQLDLSNQLLSLPGDDYRDPEGTDTRNYGGQHGLPGLRAIFAELLGIAVPNLIAGNNSSLELMHDIVAFSMLYGGVDSPRPWIQEQDGIKFLCPVPGYDRHFAITETMGIEMIPIPMLQDGPDVDLIEELVAVDPAIKGMWTVPVFGNPSGVTYSWETVRRLVQMRTAAPDFRLFWDNAYAVHTLTLDFPRQVDVLGLAAKAGNPNRPYVFASTSKITFAGGGVSFFGGSLGNIAWYLQYAGKKSIGPDKVNQLRHLRFFGDADGVRLHMLRHQQILAPKFALVAEVLDQRLSESKIASWTEPKGGYFISLDVLPGTARRTVALAKDVGIAVTEAGASFPYRKDPDDKNIRIAPSFPSVPDLRNAVDGLATCALLAATETLLNQGLASSAPNVR lprd_myctu Putative lipoprotein LprD lprD MTCY02B10.07c Rv1343c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARKQNRTTA psb_myctu Proteasome subunit beta Proteasome core protein PrcB Rv2110c prcB 20S proteasome beta subunit protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPLLAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGGPDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK 3FC3FCD81231E129 mint atg2b_mouse Autophagy-related protein 2 homolog B Atg2b protein protein mouse Mus musculus Mouse MPWPFSESIKKRACRYLLQRYLGHFLQEKLSLEQLSLDLYQGTGSLAQVPLDKWCLNEILESADAPLEVTEGFIQSISLSVPWGSLLQDNCALEVRGLEMVFRPRPRVATGSEPMYWSSFMTSSMQLAKECLSQKLTDEQGEASQPFEGLEKFAETIETVLRRVKVTFIDTVLRIEHVPENSKTGAALEIRVDRTVYCDETADESSGVNVHQPTAFAHKLLQLSGVSLFWDEFSASAKSSPVCSTAPVETEPKLSPSWNPKIVYEPHPQLTRTLPEIAPSDPVQIGRLLGRLELSLTLKQNEVLPGAKLDVDGQIDSFHLFLSPRQVHLLLDMLAAIAGPENSSKIGLANKDRKNRPMQQEDEYRIQMELNRYYLRKDSLSMGVSSEKSFYETETARTPSSREEEVFFSMADMDMSHSLSSLPPLGDPPHMDLELSLTSTYTNTPAGSPLSATVLQPTWGEFADHKEQPVRGPAFQSDVVHPASLQKAALSSRSASVDESRPEFICRLALGIFSVSVLHIDPLSPAETSLNVNPLTRMATDFFSCVEKMDPAIFSTGDFKSFRAVFAEACSHDHLRFIGTGIKVSYEQRQRSASRHFSTDMSVGQMEFLECLFPTDCHSVPSHYTELLTFHSKEGTDAHLPVCLQLHYKHSETRGPQGNQARLSSVPQKAELQIKLNPVCCELDISIVDRLNSLLQPQKLTTVEMMASHMYASYNKHISLHKAFTEVFLDDSHSPANRRVSVQVATPALHLSVRFPIPDLRSDQERGPWFKKSLQKETLHLEFTDLESKTEFVGGSTPEQTKLELTFRELSGSFQEEKGGPSVKFFHVSGGVDGDTASSDDFDWPRMVLKINPPAMHSILERIAAEEEEENDGHYQEEEDGGAHSLKDVCDLRRPAPSPFSSRRVMFENEQMVMPGDPVEMTEFQDKAISNSHYVLELLLPNIHLTLPNKGFYEKLYNRIFNDLLLWEPTAPSPVETLENVSYGIGLSVASQLINTFSKDSFSPFKSAVHYDEDSGSEEETLQYFSAVDPNYRSRRKKKLDSQNKNSQSFLSVLLSINHGLMAVFTDVKQENGDPMESKHGEFWLEFNSGSFFCVTKYEGFEDKHYICLHSSSLRLYHKGIVDGAILPTETRLPCSTRPHWLEPTIYSSEEDGLSRTASDGVGGDNLNMLSVAVKILSDKSESNTKEFLVAVGLKGATLQHRVLPAGLSWHEQILNFLNIADEPVLGYNPPTSFTTFHVHLWSCALDYRPLHLPLRSLLTVETFSISSSVALDKSSSTLRIIMDEAALHLSDKCNTVTVNLNRDYVRVMDMGLLELTITAVKSDSDGEQTAPRFELHCSSDVVHIRTCSDSCAALMNLIQYVASYGDLHGPHKAEMKPGVPQRKPKVDSSARSSSHGPVLPEADQQILRDLMSDAMEEIDLQQASAPVGPQANGVLDEKSHTQEPCCSDLFLFPDESGNVSQESSPAYPSLTHHLISDAVTGVTAENDDFCILFAPKTVVQEKEEEPVIKIMVDDAIVIKDDYFSLPITRTDSSKAPLHFPIPAVRYVVKEVSLVWHLYGGKDFATAPPTSPAKSYIPHSSPSQTPTRHGRHTVCGGKGRNHDFLMEIQLSKVKFQHEVYPPCKPECESSLLEHPVSRQVFIVQDLEIRDRLATSQMNKFLYLYCSKDMPRKAHSNMLTIKALHVRPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSTEVELLLTPDPEVTKSPGADVTCSLPRHLSTSKEPNLVVSFPGPKQASPNHRANSAEGGNGLEEDVSAEETSFSDQPVFFREFRFTAEVPIRLDYHGKHVSMDQGTLAGILIGLAQLNCSELKLKRLFYRHGLLGIDKLFSYAISEWLSDIKKNQLPGILGGVGPMHSLVQLVQGLKDLVWLPIEQYRKDGRIVRGFQRGAASFGTSTAMAALELTNRMVQTIQAAAETAYDMVSPSTLSIEPKKAKRFPHHRLAHQPVDLREGVAKAYSVVKEGITDTAQTIYETAAREHESRGVTGAVGEVLRQIPPAVVRPLIVATEATSNVLGGMRNQIRPDVRQDESQKWRHGED irak4_mouse Interleukin-1 receptor-associated kinase 4 Irak4 protein protein mouse Mus musculus Mouse MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTRFHSFSFHELKSITNNFDEQPASAGGNRMGEGGFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKVMATCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHTRCKVAQGTANGIRFLHENHHIHRDIKSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAKVQQLLQEMSA irak3_mouse Interleukin-1 receptor-associated kinase 3 IL-1 receptor-associated kinase M Irak3 Inactive IL-1 receptor-associated kinase 3 protein protein mouse Mus musculus Mouse MAGRCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLAERLSNSWLDVRHIEKYVNQGKSGTRELLWSWAQKNKTIGDLLEVLQDMGHQRAIHLIINYGVSWTPSVQTHHELPFPSFPPEVKHACRENDPGPLEPANVTVDNVLVPEHNEKGTLQKTPISFQSILEGTKHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFKQEKKMQLKKHWKRFLSELEVLLLFRHPHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTPLSWHVRISVLIGIAKAIQYLHNTQPCAVICGNVSSANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMTGGGRKHLWYMPEEYIRQGRLSVKTDVYSFGIVIMEVLTGCKVVLDDPKHVQLRDLLMELMEKRGLDSCLSFLDRKIPPCPRNFSAKLFSLAGRCVATKAKLRPTMDEVLSSLESTQPSLYFAEDPPTSLKSFRCPSPLFLDNVPSIPVEDDENQNNHSVPPKEVLGTDRVTQKTPFECSQSEVTFLGLDRNRGNRGSEADCNVPSSSHEECWSPELVAPSQDLSPTVISLGSSWEVPGHSYGSKPMEKRCSSGLFCSEHEQSKKQ l7n684_myctu Rv2141c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTDETGASSDHSDDVAQVVSRLIRFDTTNSGEPGTTKGEAECARWVAEQLAEVGYQPEYVESGAPGRGNVFARLAGADSSRGALLIHGHLDVVPAEPAEWSVHPFSGAIEDGYVWGRGAVDMKDMVGMMIVVARHLRQAAIVPPRDLVFAFVADEEHGGKYGSHWLVDNRPDLFDGITEAIGEVGGFSLTVPRHDGGERRLYLIETAEKGIQWMRLTARGRAGHGSMVHDQNAVTAVCEAVARLGRHQFPLVCTDTVAQFLAVVGEETGLAFDLDSPDLAGTIDKLGPMARMLKAVLHDTANPTMLKAGYKANVVPATAEAVVDCRVLPGRRAAFEAEVDALIGPDVTREWVSDLPSYETTFDGDLVAAMNAAVLAVDPDGRTVPYMLSGGTDAKAFARLGIRCFGFSPLRLPPDLDFTSLFHGVDERVPIDGLRFGTEVLTHLLTHC ephb_myctu Epoxide hydrolase B ephB Epoxide hydrolase EphB LH57_10545 Rv1938 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP e2ak3_mouse Eukaryotic translation initiation factor 2-alpha kinase 3 Eif2ak3 Pek Perk PRKR-like endoplasmic reticulum kinase Pancreatic eIF2-alpha kinase protein protein mouse Mus musculus Mouse MERATRPGPRALLLLLFLLLGCAAGISAVAPARSLLAPASETVFGLGAAAAPTSAARVPAVATAEVTVEDAEALPAAAGEPESRATEPDDDVELRPRGRSLVIISTLDGRIAALDAENDGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESSYKFGDDVVLVGGKSLITYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTVRAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKPGGNKEDSKIISDVEEQEATMLDTVIKVSVADWKVMAFSRKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTASEEALGDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTSPKALESVNGENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRERNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQPHRQRKESETQCQTESKYDSVSADVSDNSWNDMKYSGYVSRYLTDFEPIQCMGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQEEMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEQIEVIAPSPERSRSFSVGISCGQTSSSESQFSPLEFSGTDCGDNSDSADAAYNLQDSCLTDCEDVEDGTVDGNDEGHSFELCPSEASPYTRSREGTSSSIVFEDSGCGNASSKEEPRGNRLHDGNHYVNKLTDLKCSSSRSSSEATTLSTSPTRPTTLSLDFTKNTVGQLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSLEDREHGVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERVRILTDVRNLKFPLLFTQKYPQEHMMVQDMLSPSPTERPEATDIIENAIFENLEFPGKTVLRQRSRSMSSSGTKHSRQPSCSYSPLPGN o53850_myctu D-alanyl-D-alanine dipeptidase lpqR Rv0838 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRLIGRLRLLMVGLVVICGACACDRVSAGRWSESPSATSWPVRPVNTTTPSGPVPPVSEAARAAGLVDVRGVVPDAAIDLRYATANNFTGTQLYPPGARCLVHESMAEGLAAAAAVLRPHGQVLVFWDCYRPHDVQVRMFDVVPNPAWVARPGKYAHSHEAGRSVDVTFASAQRQCPSVRRSGELCLADMGTDFDDFSSRATAFATQGVSAEAQANRAHLRAAMQAGGLTVYSGEWWHFDGPGAGVDRPILEVPVD proa_myctu Gamma-glutamyl phosphate reductase proA Glutamate-5-semialdehyde dehydrogenase Glutamyl-gamma-semialdehyde dehydrogenase MTCY428.20 Rv2427c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTVPAPSQLDLRQEVHDAARRARVAARRLASLPTTVKDRALHAAADELLAHRDQILAANAEDLNAAREADTPAAMLDRLSLNPQRVDGIAAGLRQVAGLRDPVGEVLRGYTLPNGLQLRQQRVPLGVVGMIYEGRPNVTVDAFGLTLKSGNAALLRGSSSAAKSNEALVAVLRTALVGLELPADAVQLLSAADRATVTHLIQARGLVDVVIPRGGAGLIEAVVRDAQVPTIETGVGNCHVYVHQAADLDVAERILLNSKTRRPSVCNAAETLLVDAAIAETALPRLLAALQHAGVTVHLDPDEADLRREYLSLDIAVAVVDGVDAAIAHINEYGTGHTEAIVTTNLDAAQRFTEQIDAAAVMVNASTAFTDGEQFGFGAEIGISTQKLHARGPMGLPELTSTKWIAWGAGHTRPA grp1_mouse RAS guanyl-releasing protein 1 Rasgrp1 Rasgrp Calcium and DAG-regulated guanine nucleotide exchange factor II Ras guanyl-releasing protein protein protein mouse Mus musculus Mouse MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGASLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPGVCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLKDLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRIKSPAISTENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEIVDHSEESKDRTIMLLGVSSQKISVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA relb_mouse Transcription factor RelB Relb protein protein mouse Mus musculus Mouse MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLPPSALQPADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT rubic_mouse Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Rubcn Kiaa0226 protein protein mouse Mus musculus Mouse MRPEGAGMDLGGGDGERLLEKSRREHWQLLGNLKTTVEGLVSANCPNVWSKYGGLERLCRDMQNILYHGLIHDQVCCRQADYWQFVKDIRWLSPHSALHVEKFISLHESDQSDTDSVSERAVAELWLQHSLQCHCLSAQLRPLLGDRQYIRKFYTETAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKQESPLLVTKSQSLTALPGSTYTPPASYAQHSYFGSSSSLQSMPQSSHSSERRSTSFSLSGPSWQPQEDRECLSPAETQTTPAPLPSDSTLAQDSPLTAQEMSDSTLTSPLEASWVSSQNDSPSDVSEGPEYLAIGNPAPHGRTASCESHSSNGESSSSHLFSSSSSQKLESAASSLGDQEEGRQSQAGSVLRRSSFSEGQTAPVASGTKKSHIRSHSDTNIASRGAAGGPRNITIIVEDPIAEGGQYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPAYRETENGSFRVTSSSSQFSSRDSTQLSESGSAEDADDLEIQDADIRRSAVSNGKSSFSQNLSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMVVPSRILRKWDFSKYYVSNFSKDLLLKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLYHMKNMFKTCRLAKELLDSFDVVPGHLTEDLHLYSLSDLTATKKGELGPRLAELTRAGAAHVERCMLCQAKGFICEFCQNEEDVIFPFELHKCRTCEECKACYHKTCFKSGRCPRCERLQARRELLAKQSLESYLSDYEEEPTEALALEATVLETT socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL sftpa_mouse Pulmonary surfactant-associated protein A Sftpa1 Sftp1 Sftp-1 Sftpa protein protein mouse Mus musculus Mouse MSLGSLAFTLFLTVVAGIKCNGTEVCAGSPGIPGTPGNHGLPGRDGRDGIKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGEHGDKGEPGERGLPGFPAYLDEELQTASYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKYNTYPYLGVIEGQTPGDFHYLDGASVNYTNWYPGEPRGRGKEKCVEMYTDGKWNDKGCLQYRLAICEF In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration mint traf3_mouse TNF receptor-associated factor 3 CD40 receptor-associated factor 1 TRAFAMN Traf3 Craf1 Trafamn RING-type E3 ubiquitin transferase TRAF3 protein protein mouse Mus musculus Mouse MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP tsc2_mouse Tuberin Tuberous sclerosis 2 protein homolog Tsc2 protein protein mouse Mus musculus Mouse MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEILRELSGECGLNNRIRMIGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQGDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDILLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPESSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVAIKVLDVLSFVLLIIRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELEERDLAVHSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLSTLARLPHLYRNFVPEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHGHAPVQVIVSATGCTAKPPTLPRSNTVASFSSLYQPSCQGQLHRSVSWADSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKQGQFNFVHVIITPLDYKCNLLTLQCRKDGPACKCEWWRQPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRIREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV Implicated as a tumor suppressor. May have a function in vesicular transport, but may also play a role in the regulation of cell growth arrest and in the regulation of transcription mediated by steroid receptors. Interaction between TSC1 and TSC2 may facilitate vesicular docking. Specifically stimulates the intrinsic GTPase activity of the ras-related protein RAP1A and RAB5. Suggesting a possible mechanism for its role in regulating cellular growth mint ulk1_mouse Serine/threonine-protein kinase ULK1 Ulk1 Unc-51-like kinase 1 Serine/threonine-protein kinase Unc51.1 protein protein mouse Mus musculus Mouse MEPGRGGVETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHTMRTLSEDTVRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPGGRRANPSNIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPAIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASTPIKKSPPVPVPSYPSSGSGSSSSSSSASHLASPPSLGEMPQLQKTLTSPADAAGFLQGSRDSGGSSKDSCDTDDFVMVPAQFPGDLVAEAASAKPPPDSLLCSGSSLVASAGLESHGRTPSPSPTCSSSPSPSGRPGPFSSNRYGASVPIPVPTQVHNYQRIEQNLQSPTQQQTARSSAIRRSGSTTPLGFGRASPSPPSHTDGAMLARKLSLGGGRPYTPSPQVGTIPERPSWSRVPSPQGADVRVGRSPRPGSSVPEHSPRTTGLGCRLHSAPNLSDFHVVRPKLPKPPTDPLGATFSPPQTSAPQPCPGLQSCRPLRGSPKLPDFLQRSPLPPILGSPTKAGPSFDFPKTPSSQNLLTLLARQGVVMTPPRNRTLPDLSEASPFHGQQLGSGLRPAEDTRGPFGRSFSTSRITDLLLKAAFGTQASDSGSTDSLQEKPMEIAPSAGFGGTLHPGARGGGASSPAPVVFTVGSPPSGATPPQSTRTRMFSVGSSSSLGSTGSSSARHLVPGACGEAPELSAPGHCCSLADPLAANLEGAVTFEAPDLPEETLMEQEHTETLHSLRFTLAFAQQVLEIAALKGSASEAAGGPEYQLQESVVADQISQLSREWGFAEQLVLYLKVAELLSSGLQTAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDGIHGVTAERLILSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHTLTDQADIENIAKCKLCIERRLSALLSGVYA mint homomint Involved in axon growth. Plays an essential role in neurite extension of cerebellar granule cells ulk2_mouse Serine/threonine-protein kinase ULK2 Ulk2 Kiaa0623 Serine/threonine-protein kinase Unc51.2 Unc-51-like kinase 2 protein protein mouse Mus musculus Mouse MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCPVPVPVYSGPVPGSSCSSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASNSSKNSSCDTDDFVLVPHNISSDHSYDMPMGTTARRASNEFFMCGGQCQPTVSPHSETAPIPVPTQVRNYQRIEQNLISTASSGTNPHGSPRSAVVRRSNTSPMGFLRVGSCSPVPGDTVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQAPQSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGAGYSYSPQPSRPGSLGTSPTKHTGSSPRNSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKDGNDPRECSHCLSVQGSERHRSEQQQSKAVFGRSVSTGKLSEQQVKAPLGGHQGSTDSLNTERPMDVAPAGACGVMLALPAGTAASARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVGSSSSGGSLCSASGRVCVGSPPGPGLGSSPPGAEGAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNMMLMFTECVLDLTAVRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQVKSGKLSPSMAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSKILQDPTDVENVHKYKCSIERRLSALCCSTATV uvrag_mouse UV radiation resistance-associated protein Uvrag1 Uvrag protein protein mouse Mus musculus Mouse MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCDNEKIFKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQRLGKEIEEKLRLTSTSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFSTEHGKLQLQKDSLSELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGGFSAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKENKKAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQAEEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK wasp_mouse Wiskott-Aldrich syndrome protein homolog Was Wasp protein protein mouse Mus musculus Mouse MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALPPGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVPPHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVVGSNKGRSGPLPPVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQSEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD y2280_myctu-atg14-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG14 3724794 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-atg14-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG14 3724794 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-atg2a-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-atg2a-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-atg2a-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-atg2a-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-atg2a-1 3724791 N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-atg2a-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 dcd-atg2a-1 3724791 N/A Rv0321 3724802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-atg2a-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-atg2a-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-atg2a-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-atg2a-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-atg2a-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-atg2a-2 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-atg2a-2 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-atg2a-2 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-atg2a-2 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-atg2a-2 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 lprd-atg2a-1 3724791 N/A Rv1343c 3724807 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-atg2a-2 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 prcb-atg2a-1 3724791 N/A Rv2110c 3724808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-atg2a-2 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-atg2a-2 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2a 3724797 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-atg2b-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-atg2b-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-atg2b-1 3724791 N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-atg2b-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-atg2b-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-atg2b-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 prcb-atg2b-1 3724791 N/A Rv2110c 3724808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-atg2b-2 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-atg2b-2 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-atg2b-2 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-atg2b-2 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-atg2b-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-atg2b-3 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-atg2b-3 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-atg2b-3 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-atg2b-3 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-atg2b-2 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ATG2b 3724809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-irak4-1 3724791 N/A IRAK 3724810 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-irak4-1 3724791 N/A IRAK 3724810 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-irak3-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-irak3-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-irak3-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 l7n684_myctu-irak3-1 3724791 N/A Rv2141c 3724812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-irak3-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-irak3-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-irak3-1 3724791 N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-irak3-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-irak3-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-irak3-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 prcb-irak3-1 3724791 N/A Rv2110c 3724808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ephb-irak3-1 3724791 N/A Rv1938 3724813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-irak3-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A IRAK-M 3724811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-eif2ak3-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 l7n684_myctu-eif2ak3-1 3724791 N/A Rv2141c 3724812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-eif2ak3-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-eif2ak3-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-eif2ak3-1 3724791 N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-eif2ak3-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-eif2ak3-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-eif2ak3-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 lpqr-eif2ak3-1 3724791 N/A Rv0838 3724815 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-eif2ak3-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-eif2ak3-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 proa-eif2ak3-1 3724791 N/A Rv2427c 3724816 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-eif2ak3-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A PERK 3724814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-rasgrp1-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A RasGRP 3724817 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-rasgrp1-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A RasGRP 3724817 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-rasgrp1-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A RasGRP 3724817 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-rasgrp1-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A RasGRP 3724817 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-relb-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Relb 3724818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-relb-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Relb 3724818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-relb-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Relb 3724818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 lprd-relb-1 3724791 N/A Rv1343c 3724807 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Relb 3724818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 dcd-relb-1 3724791 N/A Rv0321 3724802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Relb 3724818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-relb-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Relb 3724818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-rubcn-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-rubcn-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 l7n684_myctu-rubcn-1 3724791 N/A Rv2141c 3724812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-rubcn-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-rubcn-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-rubcn-1 3724791 N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-rubcn-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 dcd-rubcn-1 3724791 N/A Rv0321 3724802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-rubcn-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 lpqr-rubcn-1 3724791 N/A Rv0838 3724815 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 prcb-rubcn-1 3724791 N/A Rv2110c 3724808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ephb-rubcn-1 3724791 N/A Rv1938 3724813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-rubcn-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-rubcn-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 proa-rubcn-1 3724791 N/A Rv2427c 3724816 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-rubcn-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A Rubicon 3724819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-socs3-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-socs3-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-socs3-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-socs3-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-socs3-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-socs3-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-socs3-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A SOCS3 3724820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-sftpa1-1 3724791 N/A SP-A 3724821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-traf3-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-traf3-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-traf3-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-traf3-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-traf3-1 3724791 N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-traf3-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 dcd-traf3-1 3724791 N/A Rv0321 3724802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 lpqr-traf3-1 3724791 N/A Rv0838 3724815 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-traf3-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-traf3-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TRAF3 3724822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 l7n684_myctu-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2141c 3724812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 dcd-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0321 3724802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 prcb-tsc2-1 3724791 N/A Rv2110c 3724808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ephb-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv1938 3724813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 proa-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2427c 3724816 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-tsc2-1 3724791 N/A TSC2 3724823 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-ulk1-1 3724791 N/A ULK1 3724824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-ulk2-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-ulk2-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 mak-ulk2-1 3724791 N/A Rv0127 3724799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-ulk2-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-ulk2-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-ulk2-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-ulk2-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-ulk2-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A ULK2 3724825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-uvrag-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-uvrag-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-uvrag-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 esxo-uvrag-1 3724791 N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A Rv2346c 3724800 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-uvrag-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-uvrag-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-uvrag-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 prcb-uvrag-1 3724791 N/A Rv2110c 3724808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ephb-uvrag-1 3724791 N/A Rv1938 3724813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-uvrag-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-uvrag-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-uvrag-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A UVRAG 3724826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o69689_myctu-was-1 3724791 N/A Rv3722c 3724806 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ugpb-was-1 3724791 N/A Rv2833c 3724796 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 glna2-was-1 3724791 N/A Rv2222c 3724798 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 l7n684_myctu-was-1 3724791 N/A Rv2141c 3724812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 y2280_myctu-was-1 3724791 N/A Rv2280 3724793 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 espl-was-1 3724791 N/A Rv3880c 3724801 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o07422_myctu-was-1 3724791 N/A Rv0178 3724795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 i6y946_myctu-was-1 3724791 N/A Rv0925c 3724803 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 lpqr-was-1 3724791 N/A Rv0838 3724815 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 ephb-was-1 3724791 N/A Rv1938 3724813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 chp2-was-1 3724791 N/A Rv1184c 3724804 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 o53319_myctu-was-1 3724791 N/A Rv3169 3724805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 proa-was-1 3724791 N/A Rv2427c 3724816 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A WASP 3724827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false ST5 proa-1 3724792 N/A 3724827 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell bifc tag bifc tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3724816 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell bifc tag bifc tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5e It is not explained in the paper the exact tags that have been used in the BiFC experiment.