IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ivanusic-2014-2 Investigation of membrane protein-protein interactions using correlative FRET-PLA. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. BioTechniques (0736-6205) 2014 Only protein-protein interactions imex curation Virus - Publications including interactions involving viral proteins ivanusic-2014-1 Investigation of membrane protein-protein interactions using correlative FRET-PLA. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. Jurkat cDNA library BioTechniques (0736-6205) 2014 Only protein-protein interactions imex curation Virus - Publications including interactions involving viral proteins ivanusic-2014-3 Investigation of membrane protein-protein interactions using correlative FRET-PLA. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Correlative FRET-PLA analysis;cell samples are processed for PLA and the next day for CFP/YFP/PLA image acquisition. NFRET - is used here (results obtained are independent of protein expression levels.) FRET interaction data was also obtained using acceptor photobleaching.(figure 3) dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. BioTechniques (0736-6205) 2014 Only protein-protein interactions imex curation Virus - Publications including interactions involving viral proteins cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM p04578-pro_0000038428 Transmembrane protein gp41 env Env polyprotein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 AVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL 512 856 cd63-env 1597914 n/a 1597917 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1597918 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nhr_chr_tm sufficient to bind sufficient binding region sufficient to bind range range range range false proximity proximity close-contact colocalization neighbourhood interaction false false false 2A cd63-env-2 1597914 n/a 1597917 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1597918 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal_igk_light chain_v-j2-c tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false protein ID=AAA38856.1 nhr_chr_tm sufficient to bind sufficient binding region sufficient to bind range range range range false proximity proximity close-contact colocalization neighbourhood interaction false false false 4G The amount of PLA signals strongly correlated with the NFRET value (Figure 2C). env-cd63 1597915 n/a 1597918 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597917 unspecified role unspecified role prey prey n_terminus nub nub n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp 1 cd63-env-1 1597916 n/a 1597918 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nhr_chr_tm sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false signal_igk_light chain_v-j2-c tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false protein ID=AAA38856.1 n/a 1597917 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false 2 B/C, 3, 4G The amount of PLA signals strongly correlated with the NFRET value (Figure 2C).