HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html hara-2014-3 Hepatitis C virus core protein suppresses mitophagy by interacting with parkin in the context of mitochondrial depolarization. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hara Y., Yanatori I., Ikeda M., Kiyokage E., Nishina S., Tomiyama Y., Toida K., Kishi F., Kato N., Imamura M., Chayama K., Hino K. Virus - Publications including interactions involving viral proteins Origin of PARK2 inferred from sequence length. khino@med.kawasaki-m.ac.jp Am. J. Pathol. (0002-9440) 2014 imex curation Only protein-protein interactions imex curation hara-2014-1 Hepatitis C virus core protein suppresses mitophagy by interacting with parkin in the context of mitochondrial depolarization. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Hara Y., Yanatori I., Ikeda M., Kiyokage E., Nishina S., Tomiyama Y., Toida K., Kishi F., Kato N., Imamura M., Chayama K., Hino K. Virus - Publications including interactions involving viral proteins khino@med.kawasaki-m.ac.jp Am. J. Pathol. (0002-9440) 2014 imex curation Only protein-protein interactions imex curation hara-2014-2 Hepatitis C virus core protein suppresses mitophagy by interacting with parkin in the context of mitochondrial depolarization. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hara Y., Yanatori I., Ikeda M., Kiyokage E., Nishina S., Tomiyama Y., Toida K., Kishi F., Kato N., Imamura M., Chayama K., Hino K. Virus - Publications including interactions involving viral proteins khino@med.kawasaki-m.ac.jp Am. J. Pathol. (0002-9440) 2014 imex curation Only protein-protein interactions imex curation q99ib8-pro_0000045592 Core protein precursor protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV STNPKPQRKTKRNTNRRPEDVKFPGGGQIVGGVYLLPRRGPRLGVRTTRKTSERSQPRGRRQPIPKDRRSTGKAWGKPGRPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLSGAARAVAHGVRVLEDGVNYATGNLPGFPFSIFLLALLSCITVPVSA 2 191 prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV core-park2-1 1771864 n/a 1771867 unspecified role unspecified role bait bait n/a 1771868 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5C park2-core-2 1771864 n/a 1771868 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1771867 unspecified role unspecified role prey prey physical association physical association false false false 5D mlp3b-park2-1 1771865 n/a 1771868 unspecified role unspecified role neutral component neutral component n/a 1771869 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7B park2-core-1 1771866 n/a 1771868 unspecified role unspecified role bait bait n/a 1771867 unspecified role unspecified role prey prey physical association physical association false false false 5A