UniProt UniProt http://www.uniprot.org kang-2014-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr J. Virol. (0022-538X) 2014 IMEx imex curation Only protein-protein interactions kang-2014-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr J. Virol. (0022-538X) 2014 IMEx imex curation Only protein-protein interactions kang-2014-1 Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr J. Virol. (0022-538X) 2014 mimix curation imex curation Only protein-protein interactions kang-2014-2 Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr J. Virol. (0022-538X) 2014 mimix curation imex curation Only protein-protein interactions kang-2014-3 Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr J. Virol. (0022-538X) 2014 mimix curation imex curation Only protein-protein interactions tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL o41932_mhv68 GAMMAHV.ORF11 11 ORF11 protein protein mhv68 Murid herpesvirus 4 (MuHV-4) Murine gammaherpesvirus 68 MAESHPWSGRPSSSPRRSSTFANYAWKHTIKPNRILIRNARPLVINFATDRLPIIKPVDQIILEDAGTVGSALNLPSESICTRPGLLLFGHYNNDVPVTPLVDFKPDEPLQVVLTAHKTIVVPPGEFVMIIVCVNFEKIKSLDLIIHEMSTSNIPLPPTCGQTFKNFNTATPSLEIYGDVIECNDDQKTCVFTAVFPGLHRRCSLHGPLNFMGFVNSVNITGTILRVYYSGVSEAAPDSILVKFKTSSAVAFSKNPCQGHVPSHDDTLIPLVYTGPTLRLLPLETISIPFNTSFVAQNPDLKAIIYDNNLKDIRISATMWTGEQTPILAHNLTAAVKLIHSGTVFARAAFFSTKENKKACTLKLCPSTILLPGGELSLDTSTLPNCFK irf3_mouse Interferon regulatory factor 3 Irf3 protein protein mouse Mus musculus Mouse METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQDAQMADFGIFQAWAEASGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPHKVYEFVTPGARDFVHLGASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVSDPSQQLPSPNVNNFLNPAPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTADMTLPWQPVTLPDPEGFLTDKLVKEYVGQVLKGLGNGLALWQAGQCLWAQRLGHSHAFWALGEELLPDSGRGPDGEVHKDKDGAVFDLRPFVADLIAFMEGSGHSPRYTLWFCMGEMWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKAYLQDLVEDMDFQATGNI mint homomint Mediates interferon-stimulated response element (ISRE) promoter activation. Functions as a molecular switch for antiviral activity. DsRNA generated during the course of an viral infection leads to IRF3 phosphorylation on the C-terminal serine/threonine cluster. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of genes under the control of ISRE. The complex binds to the IE and PRDIII regions on the IFN-alpha and IFN-beta promoters respectively. IRF-3 does not have any transcription activation domains tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL tbk1-gammahv.orf11-1 1540683 N/A 1540688 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1540689 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5D and I tbk1-gammahv.orf11-2 1540683 N/A 1540688 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9UHD2:p.Lys38Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false kinase null mutant N/A 1540689 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5G irf3-irf3-5 1540683 N/A 1540690 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1540690 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7B TBK1 (human FLAG-TBK1 cotransfected) Murine gammaherpesvirus 68 ORF11 (FLAG-ORF11 co-transfected) irf3-tbk1-3 1540683 N/A 1540690 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1540688 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7D Murine gammaherpesvirus 68 ORF11 (HA-ORF11 co-transfected) tbk1-gammahv.orf11-4 1540683 N/A 1540688 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false protein_kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1540689 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1540719 1540716 physical association physical association false false false 8A and B, 9B tbk1-gammahv.orf11-3 1540684 N/A 1540688 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1540689 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5D gammahv_orf11-tbk1-1 1540685 n/a 1540691 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1540689 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5F gammahv_orf11-tbk1-2 1540686 n/a 1540689 unspecified role unspecified role bait bait infection infection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1540691 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false 6E gammahv_orf11-tbk1-4 1540687 n/a 1540691 unspecified role unspecified role neutral component neutral component n/a 1540689 unspecified role unspecified role neutral component neutral component infection infection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6F