HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html mohamed-2014-1 Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Arch. Virol. (0304-8608) 2014 imex curation Only protein-protein interactions imex curation mohamed-2014-2 Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Arch. Virol. (0304-8608) 2014 imex curation Only protein-protein interactions imex curation mohamed-2014-3 Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Arch. Virol. (0304-8608) 2014 imex curation Only protein-protein interactions imex curation mohamed-2014-4 Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K pull down pull down western blot western blot Immuno blot Immuno blot Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Arch. Virol. (0304-8608) 2014 imex curation Only protein-protein interactions imex curation mohamed-2014-5 Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Arch. Virol. (0304-8608) 2014 imex curation Only protein-protein interactions imex curation mohamed-2014-6 Physical interaction between bovine viral diarrhea virus nonstructural protein 4A and adenosine deaminase acting on RNA (ADAR). bovin-lb9.k Bos taurus lb9.k Bovine sarcoma cell line LB9.K confocal microscopy confocal microscopy immunostaining immunostaining Mohamed Y.M., Bangphoomi N., Yamane D., Suda Y., Kato K., Horimoto T., Akashi H. Virus - Publications including interactions involving viral proteins Reference BVDV strain NADL was used instead of BVDV strains Nose or KS86-1. akashih@mail.ecc.u-tokyo.ac.jp Arch. Virol. (0304-8608) 2014 imex curation Only protein-protein interactions imex curation f1mum9_bovin ADAR protein protein bovin Bos taurus (Bovine) Bovine MDPRQGYSLNRYQARPAQGYEHSRHRHQQPERGPCRDSFQLQQIEFLKGQLPEVPLFGKQPPSLPPFLPGLWPRFPGPPARGGPLQIRGVPRGVPLRSQVLPRRFQRPFPRGHIRPWRGVDRLSSHFQGLTISQDQEQRTLELLDELGDGKATTARDLARKLQAPKKDINRVLYSLAEKGKLHQEAGSPPLWRATVPVQAQNQPSQETRAESQTPGAPSPDSSVETEGRSTPCGLEEPPEPLDMAEIKEKICDHLFNVSSSSALNLAKNIGLTKARDVNAVLIDLERQGDVYRQGTTPPIWYLTDKKRERIQIKRNKDSVPETTQAAAVLETGKTTEGPTCNSPASDASNSTVTPGKVENGQEPVVKLKLKQEATAEPVKLKPPVYDNGPSKTGYVDFENGQWATDDIPDDLNSIHAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKAKDSGRSEESYHYSSEKESEKTAESQTATPSATSFLSGKNPVTTLLECVHKLGSSCEFRLLSREGPAHDPKFQYCVAMGTHTFPTASAPSKKAAKQMAAEEAMKALQGEATSSTSSEDQPGSTNTEAFDNLESVMPNKVRRISELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGEDEKAERMGFTELPLTGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKKDSDDLGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNPQTAKDSIFEPAKGGEKLQIKKSVSFHLYISTAPCGDGALFDKSCSDRAVESTDSRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSVYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYEIAKNYFKKSLKDMGYGNWISKPQEEKNFYLCPV p19711-pro_0000038033 Non-structural protein 4A protein protein bvdvn Bovine viral diarrhea virus (isolate NADL) SSAENALLVALFGYVGYQALSKRHVPMITDIYTIEDQRLEDTTHLQYAPNAIKTDGTETELKEL 2363 2426 ns4a-adar-4 1533159 n/a 1533165 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533166 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false No figure ns4a-adar-5 1533160 n/a 1533165 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1533166 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1B ns4a-adar-1 1533161 n/a 1533166 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1533165 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A and 4 ns4a-adar-2 1533162 n/a 1533165 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533166 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2B ns4a-adar-3 1533163 n/a 1533165 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1533166 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2C adar-ns4a-1 1533164 n/a 1533165 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533166 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3