UniProt UniProt http://www.uniprot.org ghoujal-2012-1 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ghoujal B., Milev MP., Ajamian L., Abel K., Mouland AJ., Ghoujal B., Milev MP., Ajamian L., Abel K., Mouland AJ. Virus - Publications including interactions involving viral proteins Cells have been cotransfected or not with proviral DNA pNL4-3 HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. Origin of SNF8 /EAP30/Vps22 according 17714434 (Stenmark lab cloned human EAP30). andrew.mouland@mcgill.ca Biology of the cell / under the auspices of the European Cell Biology Organization 2012 IMEx imex curation Only protein-protein interactions ghoujal-2012-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 complementation protein complementation assay PCA complementation tag fluorescence tag visualisation by fluorescence tag fluorescence Ghoujal B., Milev MP., Ajamian L., Abel K., Mouland AJ., Ghoujal B., Milev MP., Ajamian L., Abel K., Mouland AJ. Virus - Publications including interactions involving viral proteins The tri-molecular fluorescence complementation (TriFC) assay used requires a RNA reporter molecule with MS2 RNA binding (stem loop) sites . The bait protein is fused to a MS2-binding protein and a venus-N tag. Fluorescence complementation is achieved when the venus-N tag (bound to the RNA reporter) and the venus-C tag (bound to the prey protein) are in close proximity. HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. Origin of SNF8 /EAP30/Vps22 according 17714434 (Stenmark lab cloned human EAP30). andrew.mouland@mcgill.ca Biology of the cell / under the auspices of the European Cell Biology Organization 2012 IMEx imex curation Only protein-protein interactions ghoujal-2012-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ghoujal B., Milev MP., Ajamian L., Abel K., Mouland AJ., Ghoujal B., Milev MP., Ajamian L., Abel K., Mouland AJ. Virus - Publications including interactions involving viral proteins Cells have been cotransfected or not with proviral DNA pNL4-3 HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. Origin of SNF8 /EAP30/Vps22 according 17714434 (Stenmark lab cloned human EAP30). andrew.mouland@mcgill.ca Biology of the cell / under the auspices of the European Cell Biology Organization 2012 IMEx imex curation Only protein-protein interactions p04591-pro_0000038594 Capsid protein p24 gag Pr55Gag protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL 133 363 o95793-2 Double-stranded RNA-binding protein Staufen homolog 1 STAU1 STAU protein protein human Homo sapiens Human MKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC snf8_human Vacuolar-sorting protein SNF8 ELL-associated protein of 30 kDa SNF8 EAP30 ESCRT-II complex subunit VPS22 protein protein human Homo sapiens Human MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP stau1-snf8-1 1788074 N/A 1788077 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1788078 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false vsrc_myristylation_signal fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1788079 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1B stau1-gag-2 1788074 N/A 1788077 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1788078 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1B snf8-gag-1 1788075 N/A 1788079 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ms2_bacteriophage_coat_protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1788077 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B snf8-stau1-1 1788075 N/A 1788078 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1788079 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection ms2_bacteriophage_coat_proteine fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2c stau1-gag-3 1788076 N/A 1788078 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1788079 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B