HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html nitta-2013-2 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Nitta S., Sakamoto N., Nakagawa M., Kakinuma S., Mishima K., Kusano-Kitazume A., Kiyohashi K., Murakawa M., Nishimura-Sakurai Y., Azuma S., Tasaka-Fujita M., Asahina Y., Yoneyama M., Fujita T., Watanabe M. Virus - Publications including interactions involving viral proteins nsakamoto.gast@tmd.ac.jp Hepatology (0270-9139) 2013 imex curation Only protein-protein interactions imex curation nitta-2013-5 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity. human-293a Homo sapiens hek293a hek293a anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta S., Sakamoto N., Nakagawa M., Kakinuma S., Mishima K., Kusano-Kitazume A., Kiyohashi K., Murakawa M., Nishimura-Sakurai Y., Azuma S., Tasaka-Fujita M., Asahina Y., Yoneyama M., Fujita T., Watanabe M. Virus - Publications including interactions involving viral proteins nsakamoto.gast@tmd.ac.jp Hepatology (0270-9139) 2013 imex curation Only protein-protein interactions imex curation nitta-2013-3 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity. human-293a Homo sapiens hek293a hek293a confocal microscopy confocal microscopy immunostaining immunostaining Nitta S., Sakamoto N., Nakagawa M., Kakinuma S., Mishima K., Kusano-Kitazume A., Kiyohashi K., Murakawa M., Nishimura-Sakurai Y., Azuma S., Tasaka-Fujita M., Asahina Y., Yoneyama M., Fujita T., Watanabe M. Virus - Publications including interactions involving viral proteins nsakamoto.gast@tmd.ac.jp Hepatology (0270-9139) 2013 imex curation Only protein-protein interactions imex curation nitta-2013-6 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta S., Sakamoto N., Nakagawa M., Kakinuma S., Mishima K., Kusano-Kitazume A., Kiyohashi K., Murakawa M., Nishimura-Sakurai Y., Azuma S., Tasaka-Fujita M., Asahina Y., Yoneyama M., Fujita T., Watanabe M. Virus - Publications including interactions involving viral proteins nsakamoto.gast@tmd.ac.jp Hepatology (0270-9139) 2013 imex curation Only protein-protein interactions imex curation nitta-2013-1 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Nitta S., Sakamoto N., Nakagawa M., Kakinuma S., Mishima K., Kusano-Kitazume A., Kiyohashi K., Murakawa M., Nishimura-Sakurai Y., Azuma S., Tasaka-Fujita M., Asahina Y., Yoneyama M., Fujita T., Watanabe M. Virus - Publications including interactions involving viral proteins nsakamoto.gast@tmd.ac.jp Hepatology (0270-9139) 2013 imex curation Only protein-protein interactions imex curation nitta-2013-4 Hepatitis C virus NS4B protein targets STING and abrogates RIG-I-mediated type I interferon-dependent innate immunity. human-293a Homo sapiens hek293a hek293a bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Nitta S., Sakamoto N., Nakagawa M., Kakinuma S., Mishima K., Kusano-Kitazume A., Kiyohashi K., Murakawa M., Nishimura-Sakurai Y., Azuma S., Tasaka-Fujita M., Asahina Y., Yoneyama M., Fujita T., Watanabe M. Virus - Publications including interactions involving viral proteins nsakamoto.gast@tmd.ac.jp Hepatology (0270-9139) 2013 imex curation Only protein-protein interactions imex curation mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH p27958-pro_0000037575 Non-structural protein 4B protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SQHLPYIEQGMMLAEQFKQKALGLLQTASRHAEVITPAVQTNWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNLLPAILSPGALAVGVVFASILRRRVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTAILSSLTVTQLLRRLHQWISSECTTPC 1712 1972 sting_human Stimulator of interferon genes protein STING1 ERIS Endoplasmic reticulum interferon stimulator MITA Mediator of IRF3 activation TMEM173 Transmembrane protein 173 protein protein human Homo sapiens Human MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS acsl4_human Long-chain-fatty-acid--CoA ligase 4 Long-chain acyl-CoA synthetase 4 ACS4 FACL4 LACS4 ACSL4 Arachidonate--CoA ligase protein protein human Homo sapiens Human MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLCNLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK ns4b-cardif-1 1445287 n/a Cardif 1445293 unspecified role unspecified role neutral component neutral component n/a NS4B 1445294 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2B and 2D ns4b-sting-4 1445287 n/a STING 1445295 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1445294 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2B and 2D ns4b-sting-facl4-1 1445287 n/a FACL4 1445296 unspecified role unspecified role unspecified role unspecified role n/a STING 1445295 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1445294 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2E ns4b-sting-8 1445288 n/a STING 1445295 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1445294 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A cardif-sting-4 1445288 n/a Cardif 1445293 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a STING 1445295 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5D NS4B inhibit Cardif-STING interaction. cardif-sting-1 1445288 n/a Cardif 1445293 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a STING 1445295 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B NS4B inhibit Cardif-STING interaction. ns4b-sting-1 1445289 n/a STING 1445295 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1445294 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 7C cardif-sting-3 1445289 n/a Cardif 1445293 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a STING 1445295 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 8B ns4b-sting-9 1445290 n/a NS4B 1445294 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a STING 1445295 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5C cardif-sting-2 1445290 n/a Cardif 1445293 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a STING 1445295 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5D NS4B inhibit Cardif-STING interaction. ns4b-cardif-2 1445291 n/a Cardif 1445293 unspecified role unspecified role neutral component neutral component n/a NS4B 1445294 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 2A and 2C ns4b-string-1 1445292 n/a STING 1445295 unspecified role unspecified role experimental role experimental role mkg tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1445294 unspecified role unspecified role experimental role experimental role mkg tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3B and 3C