IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ calvo-2012-1 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Calvo E., DeDiego ML., García P., López JA., Pérez-Breña P., Falcón A. Virus - Publications including interactions involving viral proteins afalcon@cnb.csic.es Virus research 2012 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus calvo-2012-2 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Calvo E., DeDiego ML., García P., López JA., Pérez-Breña P., Falcón A. Virus - Publications including interactions involving viral proteins afalcon@cnb.csic.es Virus research 2012 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus q19qw5_sars Accessory protein 6 ORF6 sars6 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK orf6-orf9b_cvhsa-1 3717867 N/A 3717869 unspecified role unspecified role bait bait partially purified partially purified infection infection N/A 3717870 unspecified role unspecified role prey prey infection infection physical association physical association false false false Figs. 3, 4 orf6-orf9b_cvhsa-2 3717868 N/A 3717869 unspecified role unspecified role neutral component neutral component infection infection N/A 3717870 unspecified role unspecified role neutral component neutral component infection infection colocalization colocalization false false false Fig. 5