UniProt UniProt http://www.uniprot.org byg-2012-1 NF-κB signalling is attenuated by the E7 protein from cutaneous human papillomaviruses. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Byg L.M., Vidlund J., Vasiljevic N., Clausen D., Forslund O., Norrild B. Virus - Publications including interactions involving viral proteins bodilnorrild@sund.ku.dk Virus Res. (0168-1702) 2012 imex curation Only protein-protein interactions q6ty35_9papi Protein E7 E7 protein protein human papillomavirus type 93 human papillomavirus type 93 MIGKEVTLQDIVLGLTPPEPVALNCEEELPTEQDTEEEPARTAFKIIVFCGGGCGSRLRIFVAATEFGVRCFQQLLVKELDLLCPNCRNSDLQHGGQ ikka_human Inhibitor of nuclear factor kappa-B kinase subunit alpha CHUK IKKA TCF16 I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Transcription factor 16 protein protein human Homo sapiens Human MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE ve7_hpv20 Protein E7 E7 protein protein hpv20 Human papillomavirus type 20 MIGKEVTLQDIVLELNELQPEVQPVDLFCEEELPNEQQEREEEPQIERASYKVVAPCGCCKVKLRIFISATEFAIRSFQQLLIDELQLLCPDCRGNCKHGGS ve7_hpv37 Protein E7 E7 protein protein hpv37 Human papillomavirus type 37 MIGKEATIPEIVLELQELVQPTADLHCYEELSEEETEEERPHIPYKIVAPCCFCGSKLRLIVVATPIGIRSQEELLLGEVQLVCPNCRGKLRHD ve7_hpv38 Protein E7 E7 protein protein hpv38 Human papillomavirus type 38 MIGKQATLRDIVLEELVQPIDLHCHEELPDLPEDIEASVVEEEPAYTPYKIIVLCGGCEVRLKLYVWATDAGIRNLQDCLLGDVRLLCPTCREDIRNGGR q6ty28_9papi Protein E7 E7 protein protein human papillomavirus type 96 human papillomavirus type 96 MIGKEATIPDIKLELQDLVLPIDLHCDEELTEEQSENLSESTVAEVEPQRTLYKIVVPCGGCDSRLKIYVSATQFGIRSLEDLLLEEPSLLCPACRNGR q8b5b5_9papi Protein E7 E7 protein protein human papillomavirus type 92 human papillomavirus type 92 MIGKQATIPDIVLDLQDLVQPIDLHCDEDLSENQEEEPAPQRIDYKIVSSCGGCGIKLRIFASCTQFGIRTLQDLLLEEIALLCPDCKNGR ve7_hpv04 Protein E7 E7 protein protein hpv04 Human papillomavirus type 4 MRGAAPTVADLNLELNDLVLPANLLSEEVLQSSDDEYEITEEESVVPFRIDTCCYRCEVAVRITLYAAELGLRTLEQLLVEGKLTFCCTACARSLNRNGR ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP q6ty35-chuk 1564951 n/a 1564952 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1B e7-chuk 1564951 n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n/a 1564954 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B e7-chuk-2 1564951 n/a 1564955 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1B e7-chuk-3 1564951 n/a 1564956 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1B q6ty28-chuk 1564951 n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n/a 1564957 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B q8b5b5-chuk 1564951 n/a 1564958 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1B e7-chuk-4 1564951 n/a 1564959 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1B e7-chuk-5 1564951 n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n/a 1564960 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B q6ty35-chuk-1 1564951 n/a 1564953 unspecified role unspecified role prey prey n/a 1564952 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1C e7-chuk-6 1564951 n/a 1564955 unspecified role unspecified role bait bait n/a 1564953 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 1C q6ty28-chuk-1 1564951 n/a 1564957 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey physical association physical association false false false 1C e7-chuk-7 1564951 n/a 1564959 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey physical association physical association false false false 1C e7-chuk-8 1564951 n/a 1564960 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey physical association physical association false false false 1C q8b5b5-chuk-1 1564951 n/a 1564958 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1564953 unspecified role unspecified role prey prey physical association physical association false false false 1C