HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html gladue-2010-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gladue DP., Holinka LG., Fernandez-Sainz IJ., Prarat MV., O'Donell V., Vepkhvadze N., Lu Z., Rogers K., Risatti GR., Borca MV. Virus - Publications including interactions involving viral proteins manuel.borca@ars.usda.gov swine macrophage Virology 2010 imex curation Only protein-protein interactions imex curation gladue-2010-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gladue DP., Holinka LG., Fernandez-Sainz IJ., Prarat MV., O'Donell V., Vepkhvadze N., Lu Z., Rogers K., Risatti GR., Borca MV. Virus - Publications including interactions involving viral proteins manuel.borca@ars.usda.gov Virology 2010 imex curation Only protein-protein interactions imex curation sumo1_pig Small ubiquitin-related modifier 1 protein protein pig Sus scrofa (Pig) Pig SPAWLHSUMOPIGSMALLUBIQUITINRELATEDMODIFIEROSSUSSCROFAGNSUMOPESVMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV p21530-pro_0000038063 Capsid protein C protein protein csfvb Classical swine fever virus (strain Brescia) Hog cholera virus SDDGASASKEKKPDRINKGKLKIAPKEHEKDSRTKPPDATIVVEGVKYQVKKKGKVKGKNTQDGLYHNKNKPPESRKKLEKALLAWAVIAIMLYQPVAA 169 267 i3lsz1_pig SUMO-conjugating enzyme protein protein pig Sus scrofa (Pig) Pig TRILSZILSZPIGSUMOCONJUGATINGENZYMEOSSUSSCROFAGNUBEIPESVMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS core-sumo1-1 2857667 N/A 2857669 unspecified role unspecified role prey prey N/A 2857670 unspecified role unspecified role bait bait physical association physical association false false false results core-ubc9-1 2857667 N/A 2857671 unspecified role unspecified role prey prey N/A 2857670 unspecified role unspecified role bait bait physical association physical association false false false results core-sumo1-2 2857668 N/A 2857669 unspecified role unspecified role prey prey N/A 2857670 unspecified role unspecified role bait bait P21530-PRO_0000038063:p.Lys53Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P21530-PRO_0000038063:p.[Lys11Ala;Lys12Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 2857681 2857682 2857683 2857684 physical association physical association false false false 1 & 4 core-ubc9-2 2857668 N/A 2857671 unspecified role unspecified role prey prey N/A 2857670 unspecified role unspecified role bait bait P21530-PRO_0000038063:p.Lys52Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 & 4