UniProt UniProt http://www.uniprot.org horst-2009-2 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins CoIPs depicted fig 3B not included as the anti-bait antibodies used are not specific. M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-3 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-4 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-lcl_modo Homo sapiens LCL lymphoblastoid cell line donor MoDo, in vitro transformed EBV-positive lcl_modo LCL lymphoblastoid cell line donor MoDo, in vitro transformed EBV-positive anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-5 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-t2 Homo sapiens T cell leukemia/B cell line hybridoma HLA-A2-positive, TAP negative t2 T cell leukemia/B cell line hybridoma HLA-A2-positive, TAP negative ATCC CRL-1992 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-8 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-akbm Homo sapiens EBV positive Burkitt's lymphoma B cell line akbm EBV positive Burkitt's lymphoma B cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins Incubated with anti-IgG to induce productive EBV infection. M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-6 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-220 Homo sapiens 220 220 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-7 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-akbm Homo sapiens EBV positive Burkitt's lymphoma B cell line akbm EBV positive Burkitt's lymphoma B cell line confocal microscopy confocal microscopy immunostaining immunostaining Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation horst-2009-1 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation. human-mel_juso Homo sapiens mel_juso fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Horst D., van Leeuwen D., Croft N.P., Garstka M.A., Hislop A.D., Kremmer E., Rickinson A.B., Wiertz E.J., Ressing M.E. Virus - Publications including interactions involving viral proteins M.E.Ressing@lumc.nl J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation tap2_human Antigen peptide transporter 2 ATP-binding cassette sub-family B member 3 Peptide transporter TAP2 Peptide supply factor 2 Peptide transporter PSF2 Peptide transporter involved in antigen processing 2 TAP2 ABCB3 PSF2 RING11 Y1 Really interesting new gene 11 protein protein protein human Homo sapiens Human MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL tpsn_human Tapasin TAP-binding protein TAP-associated protein NGS-17 TAPBP NGS17 TAPA protein protein human Homo sapiens Human MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLRPQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSAFLLLGLFKALGWAAVYLSTCKDSKKKAE tap1_human Antigen peptide transporter 1 ABCB2 PSF1 RING4 Y3 TAP1 Peptide transporter TAP1 ATP-binding cassette sub-family B member 2 Peptide supply factor 1 Peptide transporter PSF1 Peptide transporter involved in antigen processing 1 Really interesting new gene 4 protein protein protein human Homo sapiens Human MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPAAALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE bnl2a_ebvb9 Protein BNLF2a BNLF2a protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI calx_human Calnexin CANX Major histocompatibility complex class I antigen-binding protein p88 p90 IP90 protein protein human Homo sapiens Human MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE tap1-bnl2a-1 1530073 n/a 1530081 unspecified role unspecified role prey prey n/a 1530082 unspecified role unspecified role prey prey n/a 1530083 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 3A tap2-bnl2a 1530073 n/a 1530081 unspecified role unspecified role bait bait n/a 1530083 unspecified role unspecified role prey prey n/a 1530082 unspecified role unspecified role prey prey n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 3A tapbp-tap1 1530073 n/a 1530081 unspecified role unspecified role prey prey n/a 1530082 unspecified role unspecified role bait bait n/a 1530083 unspecified role unspecified role prey prey association association false false false 3A tap1-tap2 1530073 n/a 1530083 unspecified role unspecified role bait bait n/a 1530082 unspecified role unspecified role prey prey n/a 1530081 unspecified role unspecified role prey prey association association false false false 3A tap2-tap1 1530073 n/a 1530082 unspecified role unspecified role prey prey n/a 1530083 unspecified role unspecified role prey prey n/a 1530081 unspecified role unspecified role bait bait association association false false false 3A tapbp-bnl2a-5 1530073 n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530082 unspecified role unspecified role bait bait n/a 1530083 unspecified role unspecified role prey prey n/a 1530081 unspecified role unspecified role prey prey association association false false false 3A tap2-bnl2a-1 1530074 n/a 1530081 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 4B tapbp-bnl2a-1 1530074 n/a 1530082 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 4B tap1-bnl2a-2 1530074 n/a 1530083 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 4B tap2-bnl2a-2 1530075 n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction n/a 1530081 unspecified role unspecified role bait bait physical association physical association false false false 5D tap1-bnl2a-3 1530075 n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction n/a 1530083 unspecified role unspecified role bait bait physical association physical association false false false 5D tapbp-bnl2a-2 1530075 n/a 1530082 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 5D tap1-bnl2a-7 1530076 n/a 1530081 ancillary ancillary unspecified role unspecified role nucl transfection nucleic acid transfection nucl transfection n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction n/a 1530083 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5D tap2-bnl2a-3 1530076 n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction n/a 1530081 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5D tapbp-bnl2a-6 1530076 n/a 1530081 ancillary ancillary unspecified role unspecified role nucl transfection nucleic acid transfection nucl transfection n/a 1530082 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 5D tapbp-bnl2a-8 1530077 n/a 1530083 unspecified role unspecified role prey prey n/a 1530082 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey infection infection Replacement of the 4 cysteine residues by alanine did not change the interaction association association false false false 7C tap2-bnl2a-6 1530077 n/a 1530083 unspecified role unspecified role prey prey n/a 1530084 unspecified role unspecified role prey prey infection infection Replacement of the 4 cysteine residues by alanine did not change the interaction n/a 1530081 unspecified role unspecified role bait bait association association false false false 7C tap1-bnl2a-8 1530077 n/a 1530083 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey infection infection Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 7C tap2-bnl2a-4 1530078 n/a 1530081 unspecified role unspecified role bait bait n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction physical association physical association false false false 5D tap1-bnl2a-5 1530078 n/a 1530084 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Replacement of the 4 cysteine residues by alanine did not change the interaction n/a 1530083 unspecified role unspecified role bait bait physical association physical association false false false 5D bnl2a-canx 1530079 n/a 1530085 unspecified role unspecified role neutral component neutral component n/a 1530084 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7B bnl2a-canx-1 1530079 n/a 1530083 unspecified role unspecified role neutral component neutral component n/a 1530084 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 7Bi bnl2a-tap1 1530080 n/a 1530084 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530083 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 1B