HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html witteveldt-2009-1 CD81 is dispensable for hepatitis C virus cell-to-cell transmission in hepatoma cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Witteveldt J., Evans M.J., Bitzegeio J., Koutsoudakis G., Owsianka A.M., Angus A.G., Keck Z.Y., Foung S.K., Pietschmann T., Rice C.M., Patel A.H. Virus - Publications including interactions involving viral proteins a.patel@mrcvu.gla.ac.uk J. Gen. Virol. (0022-1317) 2009 imex curation Only protein-protein interactions imex curation witteveldt-2009-2 CD81 is dispensable for hepatitis C virus cell-to-cell transmission in hepatoma cells. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Witteveldt J., Evans M.J., Bitzegeio J., Koutsoudakis G., Owsianka A.M., Angus A.G., Keck Z.Y., Foung S.K., Pietschmann T., Rice C.M., Patel A.H. Virus - Publications including interactions involving viral proteins a.patel@mrcvu.gla.ac.uk J. Gen. Virol. (0022-1317) 2009 imex curation Only protein-protein interactions imex curation q99ib8-pro_0000045595 Envelope glycoprotein E1 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV AQVKNTSSSYMVTNDCSNDSITWQLEAAVLHVPGCVPCERVGNTSRCWVPVSPNMAVRQPGALTQGLRTHIDMVVMSATFCSALYVGDLCGGVMLAAQVFIVSPQYHWFVQECNCSIYPGTITGHRMAWDMMMNWSPTATMILAYVMRVPEVIIDIVSGAHWGVMFGLAYFSMQGAWAKVIVILLLAAGVDA 192 383 q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 cd81_human CD81 antigen 26 kDa cell surface protein TAPA-1 Target of the antiproliferative antibody 1 Tetraspanin-28 CD81 TAPA1 TSPAN28 protein protein human Homo sapiens Human MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY e1-e2-13 1457713 n/a E1 1457715 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a E2 1457716 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1A and 1B e1-e2-14 1457713 n/a E1 1457715 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a E2 1457716 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1A and 1B e2-cd81-3 1457714 n/a E2 1457716 unspecified role unspecified role unspecified role unspecified role Q99IB8-PRO_0000045596:p.Asn151Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q99IB8-PRO_0000045596:p.Thr145Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma n/a CD81 1457717 unspecified role unspecified role unspecified role unspecified role gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3A