HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html van-2009-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa tag visualisation tag visualisation Van de Walle GR., Kaufer BB., Chbab N., Osterrieder N. Virus - Publications including interactions involving viral proteins From reference 20, EHV-1 wild-type strain RacL11 is used no34@cornell.edu, no.34@fu-berlin.de The Journal of biological chemistry 2009 imex curation Only protein-protein interactions imex curation gg_ehv1b Envelope glycoprotein G gG 70 protein protein EHV-1 Equine herpesvirus 1 (strain Ab4p) Equine abortion virus MLTVLAALSLLSLLTSATGRLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIAIKAESKGCELILLDPPIDVSYRREDKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIVNMSLLFQPGIYDSGNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMDNASPHPRAVGCFPEPIDNEAWANVTFTELGIPDPNSFLDDEGDYPNISDCHSWESYTYPNTLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAKNLETHVPSSAAESSLENQSTQEESNSPEVAHLRSVNSDDSTHTGGASNGIQDCDSQLKTVYACLALIGLGTCAMIGLIVYICVLRSKLSSRNFSRAQNVKHRNYQRLEYVA il8_horse Interleukin-8 CXCL8 IL8 C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 protein protein horse Equus caballus (Horse) Horse MTSKLAVALLAVFLLSAALCEAAVVSRITAELRCQCIKTHSKPFNPKLIKEMRAIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP gg-il2-1 1936508 N/A 1936509 unspecified role unspecified role prey prey purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1936510 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 3B,4B and 6A cxcl8-gg-1 1936508 N/A 1936509 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1936510 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 3B cxcl8-gg-2 1936508 N/A 1936509 competitor competitor competitor prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1936509 unspecified role unspecified role prey prey purified purified c terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 1936510 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 7