IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chen-2009-48 in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins dxliu@imcb.a-star.edu.sg Virology 2009 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus chen-2009-45 in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins Cross-linking agent: Glutaraldehyde (CHEBI:64276) dxliu@imcb.a-star.edu.sg Virology 2009 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus chen-2009-46 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins dxliu@imcb.a-star.edu.sg Virology 2009 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus chen-2009-47 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins dxliu@imcb.a-star.edu.sg Virology 2009 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus p0c6v3-pro_0000338322 Non-structural protein 9 ORF1a polyprotein 1a protein protein ibvb ibvb IBV NNELMPHGVKTKACVAGVDQAHCSVESKCYYTNISGNSVVAAITSSNPNLKVASFLNEAGNQIYVDLDPPCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQ 3673 3783 aibv_rna_3'utr Avian infectious bronchitis virus-ssrna-3'UTR rna ribonucleic acid RNA rna aibv Avian infectious bronchitis virus-Beaudette strain TGAGTAACATAATGGACCTGTTGTTTCCTGGTACATTTTGTTAAACACTATTTCTGTGCTTTCCTATCAATTATTACAGGCATTGATTGTGATTATGTTCAATACTTAAGCTTCTTTTGGTTGCTTTTTGCTTATTGTATTGTTGCTGTGCTTTTTATTGTTGTGATTCTCATTAGTTTGCTTTATCGTAGAAATTCAATAGTAAGAGTTAAGGAAGATAGGCATGTAGCTTGATTACCTACATGTCTATCGCCAGGGAAATGTCTAATCTGTCTACTTAGTAGCCTGGAAACGAACGGTAGACCCTTAGATTTTAATTTAGTTTAATTTTTAGTTTAGTTTAAGTTAGTTTAGAGTAGGTATAAAGATGCCAGTGCCGGGGCCACGCGGAGTACGATCGAGGGTACAGCACTAGGACGCCCATTAGGGGAAGAGCTAAATTTTAGTTTAAGTTAAGTTTAATTGGCTAAGTATAGTTAAAATTTATAGGCTAGTATAGAGTTAGAGCA aibv_rna_antisense_3'utr Avian infectious bronchitis virus-ssrna-antisense-3'UTR rna ribonucleic acid RNA rna aibv Avian infectious bronchitis virus-Beaudette strain TGCTCTAACTCTATACTAGCCTATAAATTTTAACTATACTTAGCCAATTAAACTTAACTTAAACTAAAATTTAGCTCTTCCCCTAATGGGCGTCCTAGTGCTGTACCCTCGATCGTACTCCGCGTGGCCCCGGCACTGGCATCTTTATACCTACTCTAAACTAACTTAAACTAAACTAAAAATTAAACTAAATTAAAATCTAAGGGTCTACCGTTCGTTTCCAGGCTACTAAGTAGACAGATTAGACATTTCCCTGGCGATAGACATGTAGGTAATCAAGCTACATGCCTATCTTCCTTAACTCTTACTATTGAATTTCTACGATAAAGCAAACTAATGAGAATCACAACAATAAAAAGCACAGCAACAATACAATAAGCAAAAAGCAACCAAAAGAAGCTTAAGTATTGAACATAATCACAATCAATGCCTGTAATAATTGATAGGAAAGCACAGAAATAGTGTTTAACAAAATGTACCAGGAAACAACAGGTCCATTATGTTACTCA aibv_rna_3'utr-pro_0000338322-1 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3713905 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (middle panel lanes 1 and 2) aibv_rna_antisense_3'utr-pro_0000338322-1 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3713906 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (bottom panel lanes 1 and 2) aibv_rna_3'utr-pro_0000338322-2 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Lys51Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Lys90Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Lys10Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Tyr31Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3713905 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (middle panel lanes 3-8), Fig. 5b middle plane aibv_rna_3'utr-pro_0000338322-3 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Lys10Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Tyr31Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Only weak interaction was observed ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3713905 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (middle panel lanes 3-8), Fig. 5b middle panel Only weak interaction was observed for p.Gly98Asp mutant aibv_rna_antisense_3'utr-pro_0000338322-3 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Gly98Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3713906 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (bottom panel lanes 3-8) aibv_rna_antisense_3'utr-pro_0000338322-4 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Ile95Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3713906 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (bottom panel lanes 3-8) aibv_rna_3'utr-pro_0000338322-4 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3713905 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (middle panel lanes 1 and 2) aibv_rna_antisense_3'utr-pro_0000338322-5 3713900 N/A 3713904 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3713906 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 4a (bottom panel lanes 1 and 2) pro_0000338322-1 3713901 N/A 3713904 unspecified role unspecified role neutral component neutral component purified purified P0C6V3-PRO_0000338322:p.Lys10Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Tyr31Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Lys51Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Lys90Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figs. 3a, 5a pro_0000338322-2 3713902 N/A 3713904 unspecified role unspecified role neutral component neutral component purified purified P0C6V3-PRO_0000338322:p.Lys51Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Lys90Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Lys10Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Tyr31Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Ile95Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figs. 3b, 5a pro_0000338322-pro_0000338322-1 3713903 N/A 3713904 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0C6V3-PRO_0000338322:p.Ile95Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 3713904 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3c