HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html ronecker-2008-1 Formation of bovine viral diarrhea virus E1-E2 heterodimers is essential for virus entry and depends on charged residues in the transmembrane domains. mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. comigration in gel comigration in gel electrophoresis comigration in gel anti tag western anti tag western blot anti tag western Ronecker S., Zimmer G., Herrler G., Greiser-Wilke I., Grummer B. Virus - Publications including interactions involving viral proteins beatrice.grummer@ tiho-hannover.de J. Gen. Virol. (0022-1317) 2008 imex curation Only protein-protein interactions imex curation ronecker-2008-2 Formation of bovine viral diarrhea virus E1-E2 heterodimers is essential for virus entry and depends on charged residues in the transmembrane domains. mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. comigration in gel comigration in gel electrophoresis comigration in gel western blot western blot Immuno blot Immuno blot Ronecker S., Zimmer G., Herrler G., Greiser-Wilke I., Grummer B. Virus - Publications including interactions involving viral proteins beatrice.grummer@ tiho-hannover.de J. Gen. Virol. (0022-1317) 2008 imex curation Only protein-protein interactions imex curation p19711-pro_0000038028 Envelope glycoprotein E2 protein protein bvdvn Bovine viral diarrhea virus (isolate NADL) ATTTAFLVCLVKIVRGQMVQGILWLLLITGVQGHLDCKPEFSYAIAKDERIGQLGAEGLTTTWKEYSPGMKLEDTMVIAWCEDGKLMYLQRCTRETRYLAILHTRALPTSVVFKKLFDGRKQEDVVEMNDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSEGPVEKTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLEVTDHHRDYFAESILVVVVALLGGRYVLWLLVTYMVLSEQKALG 660 1066 p19711-pro_0000038027 Envelope glycoprotein E1 protein protein bvdvn Bovine viral diarrhea virus (isolate NADL) ASPYCDVDRKIGYIWYTKNCTPACLPKNTKIVGPGKFGTNAEDGKILHEMGGHLSEVLLLSLVVLSDFAPETASVMYLILHFSIPQSHVDVMDCDKTQLNLTVELTTAEVIPGSVWNLGKYVCIRPNWWPYETTVVLAFEEVSQVVKLVLRALRDLTRIWNA 498 659 e1-e2-11 1539043 n/a 1539045 unspecified role unspecified role neutral component neutral component P19711-PRO_0000038028:p.Gly387Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1539046 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4a and 6a e2-e2-1 1539044 n/a 1539045 unspecified role unspecified role neutral component neutral component n/a 1539045 unspecified role unspecified role neutral component neutral component physical association physical association false false false 4a