HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html doceul-2008-5 pig-max Max kidney cell line Pig pig-max Max kidney cell line Max kidney cell line from an inbred NIH minipig major histocompatibility complex d/d haplotype pull down pull down western blot western blot Immuno blot Immuno blot Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk The Journal of general virology 2008 imex curation Only protein-protein interactions imex curation doceul-2008-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk human liver cDNA library The Journal of general virology 2008 imex curation Only protein-protein interactions imex curation doceul-2008-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk The Journal of general virology 2008 imex curation Only protein-protein interactions imex curation doceul-2008-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk The Journal of general virology 2008 imex curation Only protein-protein interactions imex curation doceul-2008-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk The Journal of general virology 2008 imex curation Only protein-protein interactions imex curation ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL p21530-pro_0000038062 N-terminal protease protein protein csfvb Classical swine fever virus (strain Brescia) Hog cholera virus MELNHFELLYKTNKQKPMGVEEPVYDVTGRPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRRGDCRSGNHLGPVSGIYVKPGPVFYQDYMGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCIDGCILLKLAKRGEPRTLKWIRNLTDCPLWVTSC 1 168 ikba_pig NF-kappa-B inhibitor alpha NFKBIA IKBA ECI-6 I-kappa-B-alpha protein protein pig Sus scrofa (Pig) Pig MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAPRGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVLGGQRLTL pro_0000038062-nfkbia-3 2858050 N/A 2858055 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2858056 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 pro_0000038062-nfkbia-4 2858050 N/A 2858057 unspecified role unspecified role prey prey purified purified N/A 2858056 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 pro_0000038062-nfkbia-5 2858050 N/A 2858057 unspecified role unspecified role prey prey purified purified v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2858056 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 nfkbia-pro_0000038062-1 2858050 N/A 2858057 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2858056 unspecified role unspecified role prey prey purified purified physical association physical association false false false 3 npro-ikbalpha-1 2858051 N/A 2858055 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2858056 unspecified role unspecified role bait bait physical association physical association false false false results pro_0000038062-nfkbia-1 2858052 N/A 2858055 unspecified role unspecified role prey prey clone15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2858056 unspecified role unspecified role bait bait physical association physical association false false false 1 Full length hIkBa was unable to interact with CSFV Npro. . npro-nfkbia-2 2858053 N/A 2858055 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2858056 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 pro_0000038062-nfkbia-2 2858054 N/A 2858057 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2858056 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 & 3