MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint foster-2008-1 Functional and physical interactions of the herpes simplex virus type 1 UL20 membrane protein with glycoprotein K. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Foster TP., Chouljenko VN., Kousoulas KG. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2008 rapid curation rapid curation foster-2008-2 Functional and physical interactions of the herpes simplex virus type 1 UL20 membrane protein with glycoprotein K. unknown Unknown pull down pull down predetermined predetermined participant predetermined Foster TP., Chouljenko VN., Kousoulas KG. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2008 rapid curation rapid curation foster-2008-3 Functional and physical interactions of the herpes simplex virus type 1 UL20 membrane protein with glycoprotein K. unknown Unknown fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Foster TP., Chouljenko VN., Kousoulas KG. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2008 rapid curation rapid curation gk_hhv11 Envelope glycoprotein K UL53 gK Syncytial protein protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPTGTNNDTALVWMKMNQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDAMNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVSPAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYHRPAIGVIVGCELMLRFVAVGLIVGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCILRRGPAPKNADKAAAPGRSKGLSGVCGRCCSIILSGIAVRLCYIAVVAGVVLVALHYEQEIQRRLFDV mint ul20_hhv11 Protein UL20 UL20 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MTMRDDLPLVDRDLVDEAAFGGEEGELPLEEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKRVILFLWSFLVLKPLEMVAAGMYYGLTGRVVAPACILAAIVGYYVTWAVRALLLYVNIKRDRLPLSAPVFWGMSVFLGGTALCALFAAAHETFSPDGLFHFIATNQMLPPTDPLRTRALGIACAAGASMWVAAADSFAASANFFLARFWTRAILNAPVAF mint gk-ul20 760166 gk_hhv11 760169 unspecified role unspecified role bait bait ul20_hhv11 760170 unspecified role unspecified role prey prey physical association physical association false false false F3 F4 homomint mint ul20-gk 760166 gk_hhv11 760169 unspecified role unspecified role prey prey ul20_hhv11 760170 unspecified role unspecified role bait bait physical association physical association false false false F3 F4 homomint mint ul20-gk-1 760167 gk_hhv11 760169 unspecified role unspecified role prey prey ul20_hhv11 760170 unspecified role unspecified role bait bait physical association physical association false false false F6 homomint mint gk-ul20-1 760168 gk_hhv11 760169 unspecified role unspecified role neutral component neutral component ul20_hhv11 760170 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F7 homomint mint