MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ikegami-2008-1 TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation ikegami-2008-2 TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. human-testis Homo sapiens testis anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation ikegami-2008-3 TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation ikegami-2008-4 TTLL10 is a protein polyglycylase that can modify nucleosome assembly protein 1. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Ikegami K., Horigome D., Mukai M., Livnat I., MacGregor GR., Setou M. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2008 2009-01-08 Only protein-protein interactions imex curation ttl10_human Inactive polyglycylase TTLL10 Tubulin--tyrosine ligase-like protein 10 TTLL10 protein protein human Homo sapiens Human MDHSCTRFIHRRGPPTRTRAGFKRGKRPRIQQRPRARVSGTIPASRLHPAPASQPGPCPAPGHCPVGPAHERPMGSSQEEGLRCQPSQPDHDADGHCGPDLEGAERASATPGPPGLLNSHRPADSDDTNAAGPSAALLEGLLLGGGKPSPHSTRPGPFFYIGGSNGATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQLPNNKLLTTKIGLLSTLRGRARAMSKASKVPGGVQARLEKDAAAPALEDLPWTSPGYLRPQRVLRMEEFFPETYRLDLKHEREAFFTLFDETQIWICKPTASNQGKGIFLLRNQEEVAALQAKTRSMEDDPIHHKTPFRGPQARVVQRYIQNPLLVDGRKFDVRSYLLIACTTPYMIFFGHGYARLTLSLYDPHSSDLGGHLTNQFMQKKSPLYMLLKEHTVWSMEHLNRYISDTFWKARGLAKDWVFTTLKKRMQQIMAHCFLAAKPKLDCKLGYFDLIGCDFLIDDNFKVWLLEMNSNPALHTNCEVLKEVIPGVVIETLDLVLETFRKSLRGQKMLPLLSQRRFVLLHNGEADPRPHLGGSCSLRRWPPLPTRQAKSSGPPMPHAPDQPGARRPAPPPLVPQRPRPPGPDLDSAHDGEPQAPGTEQSGTGNRHPAQEPSPGTAKEEREEPENARP Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. May catalyze ligation of glycine residues to tubulin mint np1l1_human Nucleosome assembly protein 1-like 1 NAP1L1 NRP NAP-1-related protein protein protein human Homo sapiens Human MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ ttll10-nap1l1 731788 ttl10_human TTLL10 731792 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell np1l1_human NAP1 731793 fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2D homomint mint ttll10-nap1l1-1 731788 ttl10_human TTLL10 731792 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell np1l1_human NAP1 731793 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2E homomint mint ttll10-nap1l1-2 731789 ttl10_human TTLL10 731792 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level np1l1_human NAP1 731793 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2F homomint mint nap1l1-ttll10 731790 ttl10_human TTLL10 731792 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false np1l1_human NAP1 731793 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint F2G nap1l1-ttll10-1 731791 ttl10_human TTLL10 731792 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false np1l1_human NAP1 731793 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified glycosylated residue glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false prerequisite-ptm enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false F2H homomint mint