HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html jennings-2008-3 RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. in vitro In vitro pull down pull down tag fluorescence tag visualisation by fluorescence tag fluorescence Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Biochemistry (0006-2960) 2008 imex curation Only protein-protein interactions imex curation jennings-2008-1 RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Biochemistry (0006-2960) 2008 imex curation Only protein-protein interactions imex curation jennings-2008-2 RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr weight identificat confirmation by molecular weight weight identificat Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Biochemistry (0006-2960) 2008 imex curation Only protein-protein interactions imex curation jennings-2008-4 RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Biochemistry (0006-2960) 2008 imex curation Only protein-protein interactions imex curation jennings-2008-5 RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins Cross-linkin agent bis(sulfosuccinimidyl)suberate (BS3) raneykevind@uams.edu Biochemistry (0006-2960) 2008 imex curation Only protein-protein interactions imex curation jennings-2008-6 RNA unwinding activity of the hepatitis C virus NS3 helicase is modulated by the NS5B polymerase. in vitro In vitro chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Jennings T.A., Chen Y., Sikora D., Harrison M.K., Sikora B., Huang L., Jankowsky E., Fairman M.E., Cameron C.E., Raney K.D. Virus - Publications including interactions involving viral proteins raneykevind@uams.edu Biochemistry (0006-2960) 2008 imex curation Only protein-protein interactions imex curation q9wmx2-pro_0000037548 Serine protease/helicase NS3 protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) APITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSSTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVIVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRMGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTTTHPITKYIMACMSADLEVVT 1027 1657 p26663-pro_0000037540 RNA-directed RNA polymerase protein protein hcvbk Hepatitis C virus genotype 1b (isolate BK) HCV SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSAGLRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSAKSKFGYGAKDVRNLSSKAVNHIHSVWKDLLEDTVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQVVMGSSYGFQYSPGQRVEFLVNTWKSKKNPMGFSYDTRCFDSTVTENDIRVEESIYQCCDLAPEARQAIKSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVNGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRVWRHRARSVRARLLSQGGRAATCGKYLFNWAVKTKLKLTPIPAASRLDLSGWFVAGYSGGDIYHSLSRARPRWFMLCLLLLSVGVGIYLLPNR 2420 3010 ns3-ns5b--1 1423683 n/a NS3 1423689 unspecified role unspecified role prey prey c-terminal fiash label fiash label FIAsH label 4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein FIAsH label c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS5B 1423690 unspecified role unspecified role bait bait direct interaction direct interaction false false false 8A confirmation by Coomassie staining. ns3-ns5b-4 1423683 n/a NS3 1423689 unspecified role unspecified role prey prey c-terminal fiash label fiash label FIAsH label 4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein FIAsH label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS5B 1423690 unspecified role unspecified role bait bait direct interaction direct interaction false false false 8B ns3-ns5b-3 1423684 n/a NS5B 1423690 unspecified role unspecified role prey prey n/a NS3 1423689 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 p26663_pro-q9wmx2_pr-1 1423685 n/a NS3 1423689 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS5B 1423690 unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 2 ns3-ns5b-5 1423686 n/a NS3 1423689 unspecified role unspecified role neutral component neutral component c-terminal fiash label fiash label FIAsH label 4',5'-bis(1,3,2-dithioarsolan-2-yl)fluorescein FIAsH label c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 1.0 n/a NS5B 1423690 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 1.0 direct interaction direct interaction false false false 9 ns5b-5 1423687 n/a NS5B 1423690 unspecified role unspecified role self self n/a NS5B 1423690 unspecified role unspecified role self self direct interaction direct interaction false false false supporting information figure 1 ns5b-1 1423688 n/a NS5B 1423690 unspecified role unspecified role self self n/a NS5B 1423690 unspecified role unspecified role self self direct interaction direct interaction false false false supporting information figure 2