MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint naba-2008-2 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Naba A., Reverdy C., Louvard D., Arpin M. Virus - Publications including interactions involving viral proteins SH2 EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation naba-2008-3 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering. pig-ln_229 Sus scrofa ln_229 Human malignant glioma cell line LN-229 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Naba A., Reverdy C., Louvard D., Arpin M. Virus - Publications including interactions involving viral proteins SH2 EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation naba-2008-4 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering. pig-ln_229 Sus scrofa ln_229 Human malignant glioma cell line LN-229 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Naba A., Reverdy C., Louvard D., Arpin M. Virus - Publications including interactions involving viral proteins SH2 EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation naba-2008-1 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Naba A., Reverdy C., Louvard D., Arpin M. Virus - Publications including interactions involving viral proteins SH2 EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation naba-2008-5 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Naba A., Reverdy C., Louvard D., Arpin M. Virus - Publications including interactions involving viral proteins SH2 EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation naba-2008-6 Spatial recruitment and activation of the Fes kinase by ezrin promotes HGF-induced cell scattering. unknown Unknown pull down pull down predetermined predetermined participant predetermined Naba A., Reverdy C., Louvard D., Arpin M. Virus - Publications including interactions involving viral proteins SH2 EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation ezri_human Ezrin EZR VIL2 p81 Cytovillin Villin-2 protein protein human Homo sapiens Human MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL fes_human Tyrosine-protein kinase Fes/Fps FES FPS Proto-oncogene c-Fes Proto-oncogene c-Fps Feline sarcoma/Fujinami avian sarcoma oncogene homolog p93c-fes protein protein human Homo sapiens Human MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNELTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGRTPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR o18922_pig protein protein pig Sus scrofa (Pig) Pig SLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNR fragmentation type: fragment mint fes-ezr 727154 ezri_human Ezrin 727160 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P15311:p.Tyr478Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false fes_human FES 727161 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The interaction is distroyed if cells are stimulated with Src family kinase inhibitors. f1b f1c homomint domino mint fes-ezr-1 727154 fes_human FES 727161 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ezri_human Ezrin 727160 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false f1e homomint domino mint ezr-fes-1 727155 fes_human FES 727161 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm ezri_human Ezrin 727160 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f2c Fes and ezrin human protein IDs have been used instead of sus scrofa IDs. homomint mint fes-o18922 727155 o18922_pig E-cadherin 727162 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell fes_human FES 727161 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm colocalization colocalization false false false f2c Fes human protein IDs has been used instead of sus scrofa IDs. mint fes-ezr-2 727156 fes_human FES 727161 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm ezri_human Ezrin 727160 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2d Fes and ezrin human protein IDs have been used instead of sus scrofa IDs. homomint mint fes-ezr-3 727156 fes_human FES 727161 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm ezri_human Ezrin 727160 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3b Fes human protein ID has been used instead of sus scrofa ID. homomint mint ezr-fes 727157 fes_human FES 727161 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ezri_human Ezrin 727160 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false nfa homomint domino mint ezr-fes-2 727158 fes_human FES_HUMAN 727161 unspecified role unspecified role unspecified role unspecified role ezri_human EZRI_HUMAN 727160 unspecified role unspecified role unspecified role unspecified role phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false association association false false false homomint mint ezr-fes-3 727159 fes_human FES_HUMAN 727161 unspecified role unspecified role unspecified role unspecified role ezri_human EZRI_HUMAN 727160 unspecified role unspecified role unspecified role unspecified role binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false association association false false false homomint mint