MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint graham-2007-1 Structure of CrmE, a virus-encoded tumour necrosis factor receptor. unknown Unknown chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Graham SC., Bahar MW., Abrescia NG., Smith GL., Stuart DI., Grimes JM. Virus - Publications including interactions involving viral proteins J. Mol. Biol. (0022-2836) 2007 rapid curation rapid curation q8uyl3_9poxv crmE B28R List195 m8259R mO259R protein protein vaccinia virus Vaccinia virus MTKVIIILGFLIINTNSLSMKCEQGVSYYNSQELKCCKLCKPGTYSDHRCDKYSDTICGHCPSDTFTSIYNRSPWCHSCRGPCGTNRVEVTPCTPTTNRICHCDSNSYCLLKASDGNCVTCAPKTKCGRGYGKKGEDEMGNTICKKCRKGTYSDIVSDSDQCKPMTR mint tnfa_human Tumor necrosis factor TNF TNFA TNFSF2 TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin protein protein human Homo sapiens Human MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL crme-tnf 759651 q8uyl3_9poxv 759652 unspecified role unspecified role neutral component neutral component tnfa_human 759653 unspecified role unspecified role neutral component neutral component physical association physical association false false false F1 homomint mint