MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cvetanov-2007-1 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation cvetanov-2007-2 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 imaging technique imaging technique microscopy predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation cvetanov-2007-3 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation cvetanovic-2007-1 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation cvetanov-2007-4 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression. mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cvetanovic M., Rooney RJ., Garcia JJ., Toporovskaya N., Zoghbi HY., Opal P. Virus - Publications including interactions involving viral proteins EMBO Rep. (1469-221X) 2007 2008-11-28 Only protein-protein interactions imex curation e4f1_mouse Transcription factor E4F1 E4F transcription factor 1 Putative E3 ubiquitin-protein ligase E4F1 Transcription factor E4F Transcription factor phi AP3 p120E4F E4f1 RING-type E3 ubiquitin transferase E4F1 protein protein mouse Mus musculus Mouse MEGAMAVRVTAAHTAEARAEAGREAGEGGVAAAAALSSGGFLGLPAPFSEEDEDDVHRCGRCQVEFTALEDFVQHKIQKTCHRAPQEALPTTPAATALLDQEVVPTAAEGGPDEPITVAHIVVEATSLAEDISHAPDLVGSGHIKEVIVAAEAEPGDVEMAEAPGSPNHQELGLLGEGEQAHVKLLVNKEGRYVCMLCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCAKCGKSFRESGALTRHLKSLTPCTEKIRFSISKDTAVGKEEVPAGSSASTVGTVTSSVAGDPMETSPVIHLVTDAKGTVIHEVHVQMQELPLGMKALTPESPDSEELPCSSENSRENLLHQAMQNSGIVLERVAGEESALEPAPPSGSSPQCLGDGSPELPLLKVEQIETQVASEAATVPRTHPCPQCSETFPTAATLEAHKRGHIAPRPFTCTQCGKAFPKAYLLKKHQEVHVHERRFRCGDCGKLYKTIAHVRGHRRVHSDERPFPCPQCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEESPSAAATVLAEDPHTVLVEFSSVVADTQEYIIEATADDTETSEATEIIEGTQTEVDSHIMKVVQQIVHQAGAGHQIIVQNVTMDQETALGSEATAADTITIATPESLTEQVAMTLASAISEGTVLTARAGPNSTEQATVTMVSSEDIEILEHGGELVIASPEGQLEVQTVIV mint an32a_mouse Acidic leucine-rich nuclear phosphoprotein 32 family member A Potent heat-stable protein phosphatase 2A inhibitor I1PP2A Acidic nuclear phosphoprotein pp32 Leucine-rich acidic nuclear protein Anp32a Anp32 Lanp protein protein mouse Mus musculus Mouse MEMDKRIYLELRNRTPSDVKELVLDNCKSIEGKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYRENVFKLLPQVMYLDGYDRDNKEAPDSDVEGYVEDDDEEDEDEEEYDEYAQLVEDEEEEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEEAGEEEGSQKRKREPDDEGEEDD hdac2_mouse Histone deacetylase 2 Hdac2 Yy1bp YY1 transcription factor-binding protein protein protein mouse Mus musculus Mouse MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP sap30_mouse Histone deacetylase complex subunit SAP30 30 kDa Sin3-associated polypeptide Sin3 corepressor complex subunit SAP30 Sap30 Sin3-associated polypeptide p30 protein protein mouse Mus musculus Mouse MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH setbp_mouse SET-binding protein Setbp1 Kiaa0437 protein protein mouse Mus musculus Mouse MEPREMLSSCRQRGSESEFLQGSSSRSPPAPGCSGEPLKGISVGGERMEPEEEDELGSGRDVDCNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRTGKNSKATKEDERNHSKKKLLTAGDPTASDLKAFQTQAYERPQKHSTLQYDPGHSQGFTSDTLKPKHQQKSSSQSHMEWSSNSDSGPATQNCFISPEAGRDTASTSKVPALEPVASFAKAQSKKGSTGGAWSQLSSSSKDLLLGSVVPSPSSHNSPATPSSSAECNGLQPLGDQDGGSTKDLPEPPTLSSKKKSSKKDMISQTLPNSDLDWVKSAQKAFETTEGKREAYSADSAQEASPARQSISSVSNPENDSSHVRITIPIKTPSLDPSNHKRKKRQSIKAVVEKIVPEKALASGISMSSEVVNRILSNSEGSKKDPRVPKLGKMIENETPSVGLETGGNAEKIVPGGASKQRKPPMVMTSPTRTEHAPSGKLSEIQHPKFAAKRRCSKAKPPAMLREAVLATAEKLMVEPPSAYPITPSSPLYTNTDSLTVITPVKKKRGRPKKQPLLTVETIHEGTSTSPVSPISREFPGTKKRKRRRNLAKLAQLVPGEDKPMSEMKFHKKVGKLGVLDKKTIKTINKMKTLKRKNILNQILSCSSSVALKAKAPPETSPGAASIESKLGKQINVSKRGTIYIGKKRGRKPRTELPPPSEEPKTAIKHPRPVSSQPDVPAVPSSFQSPVASSPAAMHPLSTQLGGSNGNLSPASTETNFSELKTMPNLQPISALPTKTQKGIHGGTWKLSPPRLMANSPSHLCEIGSLKEITLSPVSESHSEETIPSDSGIGTDNNSTSDQAEKSSESRRRYSFDFCSLDNPEAIPSDTSTKNRHGHRQKHLIVDTFLAHESLKKPKHKRKRKSLQNRDDLQFLAELEELITKFQVFRISHRGYTFYHENPYPSIFRINFDQYYPVPYIQYDPLLYLRRTSDLKSKKKRGRPAKTNDTMTKVPFLQGFSYPIPSGSYYAPYGMPYTSMPMMNLGYYGQYPAPLYLSHTLGAASPFMRPTVPPPQFHASSHVKISGATKHKAKHGVHLQGTVGMGLGDIQPSLNPPKVGGATLSSSRLHKRKHKHKRKHKEDRILGTHDNLSGLFAGKATGFSSHLLSERLSGSDKELPLVSEKSKHKERQKHQHGEASHKVSKNNFEVDTLSTLSLSDAQHWTQAKDKGDLSSEPVESCAKRYSGSGGDSTRSEGLDVFSEMNPSSDKWDSDMGGSKRRSFEGFGTYREKDIQAFKMNRKERGSYESSMSPGMPSPHLKVDQTAAHSKSEGSISAMMARKKPTAVDSVAIPSAPVLSLLAASAATSDAASSSLKKRFKRREIEAIQCEVRKMCHYTKLLSTKKNLDHVNKILKAKRLQRQSKTGNNFVKKRRGRPRKQPSQFDEDSRDQMPVLEKCIDLPSKRGQKPSLSPLALEPASGQDAVMATIEAVIHMAREAPPLPPPPPPPLPPPPPPPPPPPPLPKTARGGKRKHRPQPPAQPAQPTPQPLPQEEEVKAKRPRKSRASESDVLP mint e4f1_human Transcription factor E4F1 E4F1 E4F Putative E3 ubiquitin-protein ligase E4F1 E4F transcription factor 1 Transcription factor E4F p120E4F p50E4F RING-type E3 ubiquitin transferase E4F1 protein protein human Homo sapiens Human MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRCGRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGGGHIKEVIVAAEAELGDGEMAEAPGSPRQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSKCGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQMQELSLGMKALAPEPPVSQELPCSSEGSRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLAVAAPQLPVLEVQPLETQVASEASAVPRTHPCPQCSETFPTAATLEAHKRGHTGPRPFACAQCGKAFPKAYLLKKHQEVHVRERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEDSPAAATTVLTEDPHTVLVEFSSVVADTQEYIIEATADDAETSEATEIIEGTQTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDEETALGPEAAAADTITIATPESLTEQVAMTLASAISEGTVLAARAGTSGTEQATVTMVSSEDIEILEHAGELVIASPEGQLEVQTVIV an32a_human Acidic leucine-rich nuclear phosphoprotein 32 family member A ANP32A LANP PHAP1 C15orf1 MAPM Potent heat-stable protein phosphatase 2A inhibitor I1PP2A Acidic nuclear phosphoprotein pp32 Leucine-rich acidic nuclear protein Putative HLA-DR-associated protein I Mapmodulin protein protein human Homo sapiens Human MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD anp32a-e4f1 664328 q9qy56_mouse E4F 664333 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse Lanp 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false physical association physical association false false false F1 mint anp32a-hdac2 664328 an32a_mouse Lanp 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false hdac2_mouse Hdac2 664335 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false NFA mint anp32a-sap30 664328 sap30_mouse Sap30 664336 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse Lanp 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false physical association physical association false false false NFA mint anp32a-setbp1 664328 setbp_mouse Seb1 664337 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse Lanp 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region inferred by curator inferred by curator modelled by curator modeled by curator certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false NFA mint anp32a-hdac2-1 664328 hdac2_mouse Hdac2 664335 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse LANP 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false NFA mint anp32a-sap30-1 664328 sap30_mouse Hdac2 Sap30 664336 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse LANP 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false NFA mint anp32a-setbp1-1 664328 setbp_mouse SEB1 664337 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse LANP 664334 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false NFA mint anp32a-e4f1-1 664329 e4f1_human E4F 664338 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell an32a_human Lanp 664339 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false F2 homomint mint e4f1-anp32a 664330 an32a_human Lanp 664339 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false e4f1_human E4F 664338 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F5B F2F Interaction decreases when mutant ataxin 1 is overexpressed. homomint mint anp32a-e4f1-2 664331 an32a_human Lanp 664339 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false e4f1_human E4F 664338 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint F2G e4f1-anp32a-1 664332 q9qy56_mouse E4F 664333 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false an32a_mouse Lanp 664334 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2H mint