HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html chen-2007j-1 Ubiquitination and proteasomal degradation of interferon regulatory factor-3 induced by Npro from a cytopathic bovine viral diarrhea virus. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chen Z., Rijnbrand R., Jangra R.K., Devaraj S.G., Qu L., Ma Y., Lemon S.M., Li K. Virus - Publications including interactions involving viral proteins kuli@utmb.edu Virology (0042-6822) 2007 Only protein-protein interactions imex curation chen-2007j-2 Ubiquitination and proteasomal degradation of interferon regulatory factor-3 induced by Npro from a cytopathic bovine viral diarrhea virus. bovin-mdbk Bos taurus mdbk Madin-Darby bovine kidney cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chen Z., Rijnbrand R., Jangra R.K., Devaraj S.G., Qu L., Ma Y., Lemon S.M., Li K. Virus - Publications including interactions involving viral proteins kuli@utmb.edu Virology (0042-6822) 2007 Only protein-protein interactions imex curation irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES p19711-pro_0000038024 N-terminal protease protein protein bvdvn Bovine viral diarrhea virus (isolate NADL) MELITNELLYKTYKQKPVGVEEPVYDQAGDPLFGERGAVHPQSTLKLPHKRGERDVPTNLASLPKRGDCRSGNSRGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYVCIDGCIIIKSATRSYQRVFRWVHNRLDCPLWVTTC 1 168 irf3_bovin Interferon regulatory factor 3 IRF3 protein protein bovin Bos taurus (Bovine) Bovine MGTQKPRILPWLISQLDRGELEGVAWLGESRTRFRIPWKHGLRQDAQQEDFGIFQAWAVASGAYTPGKDKPDLPTWKRNFRSALNRKEVLRLAEDHSKDSQDPHKIYEFVNSGVRDIPEPDTSQDNGRHNTSDTQEDTLEKLLSDMDLSPGGPSNLTMASEKPPQFLQSPDSDIPALCPNSGLSENPLKQLLANEEDWEFEVTAFYRGCQVFQQTVFCPGGLRLVGSEAGDRMLPGQPIRLPDPATSLTDKSVTDYVQRVLSCLGGGLALWRAGQWLCAQRLGHCHVYWAIGEELLPSCGHKPDGEVPKDREGGVFNLGPFITDLITFIEGSRRSPLYTLWFCVGQSWPQDQPWIKRLVMVKVVPMCLRVLVDIARQGGASSLENTVDLHISNSDPLSLTPDQYMACLQDLAEDMDF npro-irf3 1539197 n/a 1539199 unspecified role unspecified role bait bait n/a 1539200 unspecified role unspecified role prey prey n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 8 Interaction happens when cells are treated with proteasome inhibitors, MG115 or epoxomicin. In figure 8A and 8C, Npro-29 and Npro-25 cells were used, respectively. npro-irf3-1 1539198 n/a 1539200 unspecified role unspecified role prey prey n terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1539201 unspecified role unspecified role bait bait physical association physical association false false false 8B The L8P mutant, which is incapable of inducing IRF-3 ubiquitination, can also interact with IRF-3. Epoxomicin -a Proteasome inhibitor.