MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cooray-2007-1 Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins J. Gen. Virol. (0022-1317) 2007 rapid curation rapid curation cooray-2007-2 Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. unknown Unknown anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins J. Gen. Virol. (0022-1317) 2007 rapid curation rapid curation cooray-2007-3 Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. unknown Unknown x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins J. Gen. Virol. (0022-1317) 2007 rapid curation rapid curation n1_vaccw Protein N1 VACWR028 N1L protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MRTLLIRYILWRNDNDQTYYNDNFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK mint bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ bid-n1-1 759608 vn01_vaccw 759611 unspecified role unspecified role prey prey bid_human 759612 unspecified role unspecified role bait bait physical association physical association false false false F4a homomint mint bax-n1-1 759608 vn01_vaccw 759611 unspecified role unspecified role prey prey bax_human 759613 unspecified role unspecified role bait bait physical association physical association false false false F4a homomint mint bad-n1 759608 vn01_vaccw 759611 unspecified role unspecified role prey prey bad_human 759614 unspecified role unspecified role bait bait physical association physical association false false false F4a homomint mint bax-n1-2 759609 vn01_vaccw 759611 unspecified role unspecified role prey prey bax_human 759613 unspecified role unspecified role bait bait physical association physical association false false false F4b homomint mint bad-n1-1 759609 vn01_vaccw 759611 unspecified role unspecified role prey prey bad_human 759614 unspecified role unspecified role bait bait physical association physical association false false false F4b homomint mint n1-n1-1 759610 vn01_vaccw 759611 unspecified role unspecified role neutral component neutral component vn01_vaccw 759611 unspecified role unspecified role neutral component neutral component physical association physical association false false false F5 homomint mint