MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint severino-2007-3 Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. unknown Unknown peptide array peptide array predetermined predetermined participant predetermined Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins J. Cell. Physiol. (0021-9541) 2007 rapid curation rapid curation severino-2007-1 Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. unknown Unknown pull down pull down predetermined predetermined participant predetermined Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins J. Cell. Physiol. (0021-9541) 2007 rapid curation rapid curation severino-2007-2 Human papillomavirus-16 E7 interacts with Siva-1 and modulates apoptosis in HaCaT human immortalized keratinocytes. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Severino A., Abbruzzese C., Manente L., Valderas AA., Mattarocci S., Federico A., Starace G., Chersi A., Mileo AM., Paggi MG. Virus - Publications including interactions involving viral proteins J. Cell. Physiol. (0021-9541) 2007 rapid curation rapid curation ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP siva_human Apoptosis regulatory protein Siva CD27-binding protein SIVA1 SIVA protein protein human Homo sapiens Human MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET siva1-e7-1 742570 ve7_hpv16 742573 unspecified role unspecified role prey prey siva_human 742574 unspecified role unspecified role bait bait physical association physical association false false false F2 homomint mint e7-siva1-1 742570 ve7_hpv16 742573 unspecified role unspecified role bait bait siva_human 742574 unspecified role unspecified role prey prey physical association physical association false false false F3 homomint mint siva1-e7 742571 siva_human 742574 unspecified role unspecified role bait bait ve7_hpv16 742573 unspecified role unspecified role prey prey physical association physical association false false false F1 F4 homomint mint e7-siva1 742572 ve7_hpv16 742573 unspecified role unspecified role bait bait siva_human 742574 unspecified role unspecified role prey prey physical association physical association false false false homomint mint