MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint shim-2007-1 In vitro synthesis, tetramerization and single channel characterization of virus-encoded potassium channel Kcv. in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Shim JW., Yang M., Gu LQ. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation q7t6v0_9phyc AN69C_291R PBCVAN69C_291R protein protein paramecium bursaria chlorella virus an69c Paramecium bursaria Chlorella virus AN69C MLVFSKFLTRTEPFMIHLVVLAMFVTIYRFFPGGFENNFSVANPDKKASWIDCLYFGVTTHSTVGFGDILPKTTGAKLCTIAHIVMVFFIVLTL mint an69c_291r-an69c_291 607518 q7t6v0_9phyc Kcv 607519 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified q7t6v0_9phyc Kcv 607519 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F1 The proteins are assembled as a tetramer homomint mint an69c_291r-1 607518 q7t6v0_9phyc Kcv 607519 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false F1 mint