UniProt UniProt http://www.uniprot.org weger-2007-3 Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Virology (0042-6822) 2007 Only protein-protein interactions imex curation weger-2007-1 Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de HEK293 cDNA Virology (0042-6822) 2007 Only protein-protein interactions imex curation weger-2007-2 Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Virology (0042-6822) 2007 Only protein-protein interactions imex curation weger-2007-4 Identification of a cytoplasmic interaction partner of the large regulatory proteins Rep78/Rep68 of adeno-associated virus type 2 (AAV-2). human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Weger S., Hammer E., Götz A., Heilbronn R. Virus - Publications including interactions involving viral proteins Viral proteins have been maped to the UniProt Adeno-associated virus 2 reference proteome strain. CoIP experiments after viral infection not included as used antibody (anti-Rep) is not specific. stefan.weger@charite.de Virology (0042-6822) 2007 Only protein-protein interactions imex curation rep68_aav2s Protein Rep68 Rep68 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRLARGHSL Essential for DNA replication mint kctd5_human BTB/POZ domain-containing protein KCTD5 KCTD5 protein protein human Homo sapiens Human MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM rep78_aav2s Protein Rep78 Rep78 protein protein aav-2 Adeno-associated virus 2 (isolate Srivastava/1982) AAV-2 MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLECFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ rep-kctd5-2 1536458 n/a 1536462 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Rep68 NLS mutant also interacted. n/a 1536463 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4 A/B , 7, 8 q89268-kctd5-2 1536458 n/a 1536463 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1536464 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Rep78 NLS mutant also interacted. physical association physical association false false false 4A and 7 rep-kctd5 1536459 n/a 1536462 unspecified role unspecified role bait bait n/a 1536463 unspecified role unspecified role prey prey physical association physical association false false false no figure rep-kctd5-1 1536460 n/a 1536462 unspecified role unspecified role bait bait dna_binding_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false nls_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1536463 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2B and C q89268-kctd5-1 1536461 n/a 1536464 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection Rep78 NLS mutant also interacted. n/a 1536463 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6 E and 8G