HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html bauhofer-2007-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bauhofer O., Summerfield A., Sakoda Y., Tratschin JD., Hofmann MA., Ruggli N. Virus - Publications including interactions involving viral proteins nicolas.ruggli@ivi.admin.ch Journal of virology 2007 imex curation Only protein-protein interactions imex curation p19712-pro_0000038050 N-terminal protease protein protein CSFV Classical swine fever virus (strain Alfort) Hog cholera virus MELNHFELLYKTSKQKPVGVEEPVYDTAGRPLFGNPSEVHPQSTLKLPHDRGRGDIRTTLRDLPRKGDCRSGNHLGPVSGIYIKPGPVYYQDYTGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCVDGCILLKLAKRGTPRTLKWIRNFTNCPLWVTSC 1 168 irf3_pig Interferon regulatory factor 3 IRF3 protein protein pig Sus scrofa (Pig) Pig MGTQKPRILPWLISQLNQGQLEGVAWLDEGHTRFRIPWKHGLRQDAQQEDFGIFQAWAEASGAYTPGKDKPDLPTWKRNFRSALNRKEALRLAEDHSKDPHDPHKIYEFVTSGVGDFPEPDTSLDLSGRYSTSDTHEDSLDKLLSGMDLASDAGPQSLTLALEQPPQLSLSPSVDAPASCPNLGVRENPLKQLLANDDEWEFQVTVFYRGCQVFQQTVCSPGGLRLVGSEAEDGTLAGQPVRLPDPAASLTDRGVADYVRRVLSCLGGGLALWRAGQWLWAQRLGHCHVYWAMGEELIPDSGHKPDGEVPKDREGGVFDLGPFIEDLIAFIEGSRRSPRYTLWFCMGQSWPQDEPWVKRLVMVKVVPMCLRALVDMARDGGASSLENTVDLHISNSHPLSLTSDQYKACLRDLVEDMDF npro-irf3-2 2845883 N/A 2845884 unspecified role unspecified role prey prey N/A 2845885 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A irf3-npro-1 2845883 N/A 2845884 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2845885 unspecified role unspecified role prey prey physical association physical association false false false 5B