MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wang-2007c-2 HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. unknown Unknown pull down pull down predetermined predetermined participant predetermined Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation rapid curation wang-2007d-1 HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation rapid curation wang-2007c-4 HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation rapid curation ve7_hpv11 Protein E7 E7 protein protein hpv11 Human papillomavirus type 11 MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription mint myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP ve7_hpv18 Protein E7 E7 protein protein hpv18 Human papillomavirus type 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ myc-e7 742372 ve7_hpv11 742375 unspecified role unspecified role prey prey myc_human 742376 unspecified role unspecified role bait bait physical association physical association false false false F1 homomint mint myc-e7-1 742372 ve7_hpv16 742377 unspecified role unspecified role prey prey myc_human 742376 unspecified role unspecified role bait bait physical association physical association false false false F1 homomint mint myc-e7-2 742372 ve7_hpv18 742378 unspecified role unspecified role prey prey myc_human 742376 unspecified role unspecified role bait bait physical association physical association false false false F1 F2 homomint mint myc-e7-4 742372 myc_human 742376 unspecified role unspecified role bait bait ve7_hpv18 742378 unspecified role unspecified role prey prey physical association physical association false false false F2 homomint mint e7-myc 742373 ve7_hpv11 742375 unspecified role unspecified role bait bait myc_human 742376 unspecified role unspecified role prey prey physical association physical association false false false Tab 1 homomint mint e7-myc-1 742373 myc_human 742376 unspecified role unspecified role prey prey ve7_hpv16 742377 unspecified role unspecified role bait bait physical association physical association false false false Tab 1 homomint mint e7-myc-2 742373 myc_human 742376 unspecified role unspecified role prey prey ve7_hpv18 742378 unspecified role unspecified role bait bait physical association physical association false false false Tab 1 F3 homomint mint e7-myc-3 742374 ve7_hpv18 742378 unspecified role unspecified role bait bait myc_human 742376 unspecified role unspecified role prey prey association association false false false F1 homomint mint myc-e7-3 742374 myc_human MYC 742376 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait ve7_hpv18 E7 742378 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey association association false false false homomint mint F1 f3