IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ricagno-2006-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ricagno S., Egloff MP., Ulferts R., Coutard B., Nurizzo D., Campanacci V., Cambillau C., Ziebuhr J., Canard B. Virus - Publications including interactions involving viral proteins Ref. 23 states that the Frankfurt-1 strain; NCBI accession No. AY291315 was used; the sequence is identical to that of P0C6X7 PRO_0000037321. Supporting Figure 5 text states that "the SARS-CoV NendoU mutant, nsp15_V291G/D300G, which was used for crystallization and structure analysis.". bruno.canard@afmb.univ-mrs.fr Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Coronavirus - Interactions investigated in the context of Coronavirus Only protein-protein interactions imex curation ricagno-2006-2 in vitro In vitro nuclease assay nuclease assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ricagno S., Egloff MP., Ulferts R., Coutard B., Nurizzo D., Campanacci V., Cambillau C., Ziebuhr J., Canard B. Virus - Publications including interactions involving viral proteins Ref. 23 states that the Frankfurt-1 strain; NCBI accession No. AY291315 was used; the sequence is identical to that of P0C6X7 PRO_0000037321. Supporting Figure 5 text states that "the SARS-CoV NendoU mutant, nsp15_V291G/D300G, which was used for crystallization and structure analysis.". bruno.canard@afmb.univ-mrs.fr Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Coronavirus - Interactions investigated in the context of Coronavirus Only protein-protein interactions imex curation p0c6x7-pro_0000037321 Uridylate-specific endoribonuclease nsp15 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQ 6430 6775 rna2 rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) CGCAGUGAGCUCCUAAUCGCCC rep-87 3711240 N/A 3711242 unspecified role unspecified role neutral component neutral component purified purified P0C6X7-PRO_0000037321:p.[Val291Gly;Asp300Gly] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 6.0 direct interaction direct interaction false false false Table 1 rep-88 3711241 N/A 3711243 enzyme target enzyme target substrate substrate neutral component neutral component 5' label 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3711242 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P0C6X7-PRO_0000037321:p.[Val291Gly;Asp300Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0C6X7-PRO_0000037321:p.Ser293Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false P0C6X7-PRO_0000037321:p.Thr340Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false P0C6X7-PRO_0000037321:p.Tyr342Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false P0C6X7-PRO_0000037321:p.Pro343Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) ncl acid cleavage nucleic acid cleavage ncl acid cleavage false false false Supporting Figure 5 and 6