DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ meier-2006-3 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Meier C., Aricescu AR., Assenberg R., Aplin RT., Gilbert RJ., Grimes JM., Stuart DI. Virus - Publications including interactions involving viral proteins dave@strubi.ox.ac.uk Structure (London, England : 1993) 2006 Only protein-protein interactions imex curation Coronavirus - Interactions investigated in the context of Coronavirus meier-2006-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Meier C., Aricescu AR., Assenberg R., Aplin RT., Gilbert RJ., Grimes JM., Stuart DI. Coronavirus - Interactions investigated in the context of Coronavirus dave@strubi.ox.ac.uk Structure (London, England : 1993) 2006 Only protein-protein interactions imex curation Virus - Publications including interactions involving viral proteins orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK orf9b_cvhsa-7 3145745 N/A 3145747 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. S1 orf9b_cvhsa-orf9b_cvhsa-4 3145745 N/A 3145747 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3145747 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. S1 orf9b_cvhsa-6 3145746 N/A 3145747 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 2.8Å Rwork - 0.266 Rfree - 0.289 Unspecified Long-chain fatty acid (C25H50O4; mass 413 Da)