HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html lipiska-2006-1 human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lipińska AD., Koppers-Lalic D., Rychłowski M., Admiraal P., Rijsewijk FA., Bieńkowska-Szewczyk K., Wiertz EJ. Virus - Publications including interactions involving viral proteins Since no UniProt entries exist for the BHV1 strain Lam (genotype 1.1) used in the study, the reference cooper strain (genotype 1.1) protein accessions Q77CE4 (GN_BHV1C) and P52370 (GM_BHV1C) have been used instead. wiertz@lumc.nl Journal of virology 2006 imex curation Only protein-protein interactions imex curation gn_bhv1c Envelope glycoprotein N gN UL49.5 protein protein bhv1c Bovine herpesvirus 1.1 (strain Cooper) BoHV-1 Infectious bovine rhinotracheitis virus MPRSPLIVAVVAAALFAIVRGRDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKESRGRG gm_bhv1c Envelope glycoprotein M protein protein Bovine herpesvirus 1 Bovine herpesvirus 1 gm-gn-1 1882131 N/A 1882132 unspecified role unspecified role bait bait N/A 1882133 unspecified role unspecified role prey prey physical association physical association false false false 1B gm_bhv1c-gn_bhv1c_1-1 1882131 N/A 1882132 unspecified role unspecified role prey prey N/A 1882133 unspecified role unspecified role bait bait physical association physical association false false false 1B