IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fielding-2006-2 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fielding BC., Gunalan V., Tan TH., Chou CF., Shen S., Khan S., Lim SG., Hong W., Tan YJ. Virus - Publications including interactions involving viral proteins bfielding@uwc.ac.za Biochemical and biophysical research communications 2006 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus fielding-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fielding BC., Gunalan V., Tan TH., Chou CF., Shen S., Khan S., Lim SG., Hong W., Tan YJ. Virus - Publications including interactions involving viral proteins bfielding@uwc.ac.za human lymphocyte cDNA library Biochemical and biophysical research communications 2006 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus fielding-2006-3 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Fielding BC., Gunalan V., Tan TH., Chou CF., Shen S., Khan S., Lim SG., Hong W., Tan YJ. Virus - Publications including interactions involving viral proteins bfielding@uwc.ac.za Biochemical and biophysical research communications 2006 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus fielding-2006-4 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Fielding BC., Gunalan V., Tan TH., Chou CF., Shen S., Khan S., Lim SG., Hong W., Tan YJ. Virus - Publications including interactions involving viral proteins bfielding@uwc.ac.za Biochemical and biophysical research communications 2006 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus sgta_human Small glutamine-rich tetratricopeptide repeat-containing protein alpha SGTA SGT Alpha-SGT Vpu-binding protein SGT1 protein protein human Homo sapiens Human MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNNPQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIRSRTPSASNDDQQE ns7a_sars ORF7a protein Accessory protein 7a Protein U122 Protein X4 7a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE vme1_sars Membrane protein M E1 glycoprotein Matrix glycoprotein Membrane glycoprotein 5 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV q5mag3_chlae protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MDNKKRLAYAIIQFLHDQLRHGGLSSDTQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEVPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNNPQIQQLMSGMISGGSNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIRSRTPSASNDDQQE ns7a_cvhsa-sgta-1 3709815 N/A 3709819 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region deltaC3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false TPR2 domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3709820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1B, Fig. 4 sgta-ns7a_cvhsa-3 3709815 N/A 3709820 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3709821 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5 ns7a_cvhsa-m-1 3709815 N/A 3709820 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3709822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 5 7a-hsgt-1 3709816 N/A 3709819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3709820 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region delta96-122 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false na The positive cDNA clones were sequenced and analyzed using BLAST; four of the positive clones contained complete ORFs that showed nucleotide sequence identity to human (h) SGT. sgta-ns7a_cvhsa-1 3709817 N/A 3709823 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1B sgta-ns7a_cvhsa-2 3709818 N/A 3709819 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3709820 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 3