MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ligon-2006-1 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Ligon LA., Shelly SS., Tokito MK., Holzbaur EL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation ligon-2006-2 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes. in vitro In vitro chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Ligon LA., Shelly SS., Tokito MK., Holzbaur EL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation ligon-2006-3 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes. in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Ligon LA., Shelly SS., Tokito MK., Holzbaur EL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation ligon-2006-4 Microtubule binding proteins CLIP-170, EB1, and p150Glued form distinct plus-end complexes. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ligon LA., Shelly SS., Tokito MK., Holzbaur EL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation clip1_human CAP-Gly domain-containing linker protein 1 CYLN1 RSN Cytoplasmic linker protein 1 Cytoplasmic linker protein 170 alpha-2 Reed-Sternberg intermediate filament-associated protein Restin CLIP1 protein protein human Homo sapiens Human MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAADREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKELEQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSKENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLSEVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRENLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLEEERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLRGENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF tba4a_human Tubulin alpha-4A chain TUBA4A Tubulin alpha-1 chain Alpha-tubulin 1 Testis-specific alpha-tubulin Tubulin H2-alpha TUBA1 protein protein human Homo sapiens Human MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE mare1_human Microtubule-associated protein RP/EB family member 1 APC-binding protein EB1 End-binding protein 1 MAPRE1 protein protein human Homo sapiens Human MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY tuba4a-clip1 357128 clip1_human 357132 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified multiple tagged multiple tagged tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding site binding region binding-associated region binding region exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 tba4a_human 357133 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false F3B homomint mint clip1-mapre1 357129 mare1_human 357134 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 clip1_human 357132 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain false H2 region multiple tagged multiple tagged tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 direct interaction direct interaction false false false F3A homomint mint clip1-tuba4a-1 357130 clip1_human 357132 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified multiple tagged multiple tagged tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding site binding region binding-associated region binding region exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain false H2 region Stoichiometry: 1.0 tba4a_human 357133 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false F2A kd 1,3 micromolar homomint mint clip1-tuba4a-2 357131 tba4a_human 357133 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 clip1_human 357132 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain false H2 region multiple tagged multiple tagged tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 1.0 direct interaction direct interaction false false false F2B kd 0,6 micromolar homomint mint