MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lee-2006k-1 Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases Biochemistry (0006-2960) 2006 partial coverage rapid curation lee-2006k-2 Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphatase assay phosphatase assay predetermined predetermined participant predetermined Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases Biochemistry (0006-2960) 2006 partial coverage rapid curation lee-2006k-3 Identification of phosphocaveolin-1 as a novel protein tyrosine phosphatase 1B substrate. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Lee H., Xie L., Luo Y., Lee SY., Lawrence DS., Wang XB., Sotgia F., Lisanti MP., Zhang ZY. Virus - Publications including interactions involving viral proteins Phosphatases Biochemistry (0006-2960) 2006 partial coverage rapid curation ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI cav1-ptpn1 766693 ptn1_human PTP-1B 766696 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cav1_human CAV1 766697 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false F2 PTP1B targets the phosphorylated tyrosine 14 homomint mint cav1-ptpn1-1 766694 cav1_human CAV1 766697 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component over-expressed over expressed level over-expressed living cell living cell ptn1_human PTP-1B 766696 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P18031:p.Asp181Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false F5 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. PTP1B targets the phosphorylated tyrosine 14. This experiment uses phosphates mutants, so called trapping mutants, that still bind to their substrates but are not able to carry the phosphorylation reaction through. Development of "substrate-trapping" mutants to identify physiological substrates of protein tyrosine phosphatases. Flint AJ, Tiganis T, Barford D, Tonks NK. Proc Natl Acad Sci U S A. 1997 Mar 4;94(5):1680-5. homomint mint ptpn1-cav1 766695 cav1_human CAV1 766697 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ptn1_human PTP-1B 766696 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F6 homomint mint