HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html levy-2005-1 chick-df-1 df-1_chick embryonic fibroblasts Chicken df-1 Primary chicken embryonic fibroblasts DF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy AM., Gilad O., Xia L., Izumiya Y., Choi J., Tsalenko A., Yakhini Z., Witter R., Lee L., Cardona CJ., Kung HJ. Virus - Publications including interactions involving viral proteins The Meq protein used is from the GA strain of the Marek's disease virus/Gallid herpesvirus 2, as given in References 2 and 3. The Genbank identifier (AAF67210.1) for this protein was found from Ref 2; Lee L. et al-2000;pmid:10823954. (in entry GenBank: AF147806.2 -Gallid herpesvirus 2, complete genome, GA strain) It has 99.1% homology with the only reviewed UniProt entry for the Meq protein -Q9DGW5. hkung@ucdavis.edu Proceedings of the National Academy of Sciences of the United States of America 2005 imex curation Only protein-protein interactions imex curation q77q71_9alph R-LORF7 Meq meq MDV005 MDV076 protein protein Gallid herpesvirus 2 Gallid herpesvirus 2 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPPPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQAPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYIQFPSDTQSTVWWFPGDGRP jun_chick Transcription factor AP-1 Proto-oncogene c-Jun JUN protein protein chick Gallus gallus (Chicken) Chicken MSAKMEPTFYEDALNASFAPPESGGYGYNNAKVLKQSMTLNLSDAASSLKPHLRNKNADILTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHNQNTLPSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSAPNYNANGMGYAPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF meq-cjun-1 1793382 n/a 1793383 unspecified role unspecified role bait bait N/A 1793384 unspecified role unspecified role prey prey physical association physical association false false false 4C