HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html saydam-2004-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Saydam O., Abril C., Vogt B., Ackermann M., Schwyzer M., Saydam O., Abril C., Vogt B., Ackermann M., Schwyzer M. Virus - Publications including interactions involving viral proteins schwyzer@vetvir.unizh.ch MDBK cDNA Journal of virology 2004 imex curation Only protein-protein interactions imex curation saydam-2004-2 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Saydam O., Abril C., Vogt B., Ackermann M., Schwyzer M., Saydam O., Abril C., Vogt B., Ackermann M., Schwyzer M. Virus - Publications including interactions involving viral proteins schwyzer@vetvir.unizh.ch Journal of virology 2004 imex curation Only protein-protein interactions imex curation ptgds_bovin Prostaglandin-H2 D-isomerase PTGDS Glutathione-independent PGD synthase Lipocalin-type prostaglandin-D synthase Prostaglandin-D2 synthase protein protein bovin Bos taurus (Bovine) Bovine MATPNRLWMALLLLGVLGVLQTPAPAQAALQPNFEEDKFLGRWFTSGLASNSSWFLEKKKVLSMCKSVVAPAADGGLNLTSTFLRKDQCETRTLLLRPAGPPGCYSYTSPHWSSTHEVSVAETDYETYALLYTEGVRGPGQDFRMATLYSRSQNPRAEVKEHFTTFAKSLGFTEEGIVFLPKTDKCMEEHP icp0_bhv1j E3 ubiquitin-protein ligase ICP0 BICP0 IER 2.9/ER2.6 P135 protein RING-type E3 ubiquitin transferase ICP0 protein protein BoHV-1 Bovine herpesvirus 1.1 (strain Jura) Infectious bovine rhinotracheitis virus MAPPAAAPELGSCCICLDAITGAARALPCLHAFCLACIRRWLEGRPTCPLCKAPVQSLIHSVASDECFEEIPVGGGPGADGALEPDAAVIWGEDYDAGPIDLTAADGEASGAGGEAGAADGSEAGGGAGGAEEAGEARGAGAGRAAGAAGGRAGRGADAAQEFIDRVARGPRLPLLPNTPEHGPGAPYLRRVVEWVEGALVGSFAVTARELAAMTDYVMAMLAECGFDDDGLADAMEPLIGEDDAPAFVRSLLFVAARCVTVGPSHLIPQQSAPPGGRGVVFLDTSDSDSEGSEDDSWSESEESSSGLSTSDLTAIDDTETEPETDAEVESRRTRGASGAARARRPAERQYVSTRGRQTPAVQPAPRSLARRPCGRAAAVSAPPSSRSRGGRRDPRLPAAPRAAPAAQARACSPEPREEGRGAGLGVAAGETAGWGAGSEEGRGERRARLLGEAGPPRVQARRRRRTELDRAPTPAPAPAPAPAPISTVIDLTANAPARPADPAPAAAPGPASAGAQIGTPAAAAAVTAAAAAPSVARSSAPSPAVTAAATSTAAAISTRAPTPSPAGRAPAADPRRAGAPALAGAARAEVGRNGNPGRERRPASAMARGDLDPGPESSAQKRRRTEMEVAAWVRESLLGTPRRSSAALAPQPGGRQGPSLAGLLGRCSGGSAWRQ bicp0-lpgs-1 1876159 N/A 1876161 unspecified role unspecified role prey prey N/A 1876162 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Results bicp0-ptgds-1 1876160 N/A 1876161 unspecified role unspecified role prey prey N/A 1876162 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false table 1