MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ward-2004a-2 Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. unknown Unknown pull down pull down predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2004 rapid curation rapid curation ward-2004a-3 Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. unknown Unknown protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2004 rapid curation rapid curation ward-2004a-1 Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2004 rapid curation rapid curation ward-2004a-4 Vaccinia virus A36R membrane protein provides a direct link between intracellular enveloped virions and the microtubule motor kinesin. unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Ward BM., Moss B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2004 rapid curation rapid curation a36_vaccw Protein A36 VACWR159 A36R protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MMLVPLITVTVVAGTILVCYILYICRKKIRTVYNDNKIIMTKLKKIKSSNSSKSSKSTDSESDWEDHCSAMEQNNDVDNISRNEILDDDSFAGSLIWDNESNVMAPSTEHIYDSVAGSTLLINNDRNEQTIYQNTTVVINETETVEVLNEDTKQNPNYSSNPFVNYNKTSICSKSNPFITELNNKFSENNPFRRAHSDDYLNKQEQDHEHDDIESSVVSLV mint homomint klc1_rat Kinesin light chain 1 Klc1 Klc Kns2 protein protein rat Rattus norvegicus (Rat) Rat MHDNMSTMVYMKEEKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGSSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAALRSRKQGLDNVHKQRVAEVLNDPENVEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNGMRKMKLGLVK a33_vaccw Protein A33 VACWR156 A33R protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN mint a36-klc1-1 759547 va36_vaccw 759551 unspecified role unspecified role bait bait klc1_rat 759552 unspecified role unspecified role prey prey physical association physical association false false false F2 mint a36-klc1-2 759547 va36_vaccw 759551 unspecified role unspecified role bait bait klc1_rat 759552 unspecified role unspecified role prey prey physical association physical association false false false F3 mint a36-klc1-3 759548 va36_vaccw 759551 unspecified role unspecified role neutral component neutral component klc1_rat 759552 unspecified role unspecified role neutral component neutral component physical association physical association false false false F5 mint a33-a36 759548 va33_vaccw 759553 unspecified role unspecified role neutral component neutral component va36_vaccw 759551 unspecified role unspecified role neutral component neutral component physical association physical association false false false F5 homomint mint a36-klc1 759549 va36_vaccw 759551 unspecified role unspecified role neutral component neutral component klc1_rat 759552 unspecified role unspecified role neutral component neutral component physical association physical association false false false F1 mint a33-a36-1 759550 va33_vaccw 759553 unspecified role unspecified role neutral component neutral component va36_vaccw 759551 unspecified role unspecified role neutral component neutral component physical association physical association false false false T2 homomint mint