HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html chung-2003a-2 Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw Int. J. Cancer (0020-7136) 2003 Only protein-protein interactions imex curation chung-2003a-3 Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw Int. J. Cancer (0020-7136) 2003 Only protein-protein interactions imex curation chung-2003a-4 Hepatitis C virus NS5A as a potential viral Bcl-2 homologue interacts with Bax and inhibits apoptosis in hepatocellular carcinoma. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chung Y.L., Sheu M.L., Yen S.H. Virus - Publications including interactions involving viral proteins HCV 1b isolate not specified. The reference HCV 1a isolate H is used instead. ylchung@mail.kfcc.org.tw Int. J. Cancer (0020-7136) 2003 Only protein-protein interactions imex curation p26662-pro_0000037647 Non-structural protein 5A protein protein hcvja Hepatitis C virus genotype 1b (isolate Japanese) SGSWLKDVWDWICTVLSDFKTWLQSKLLPRLPGLPFLSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPVCKPLLREEVVFQVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSAPSLKATCTTHHDSPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPIRAVEDEREISVPAEILRKPRKFPPALPIWARPDYNPPLLESWKDPDYVPPVVHGCPLPSTKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSGSSAVDSGTATGPPDQASDDGDKGSDVESYSSMPPLEGEPGDPDLSDGSWSTVSGEAGEDVVCC 1973 2419 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG ns5a-bax 1533953 n/a 1533956 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1533957 unspecified role unspecified role bait bait physical association physical association false false false 4D Interaction happens in response to stimulation with sodium phenylbutyrate (NaPB), a butyrate analogue, histone deacetylase inhibitor and inducer of apoptosis. ns5a-bax-1 1533954 n/a 1533957 unspecified role unspecified role prey prey n/a 1533956 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bh2_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4D and 6B Interaction happens in response to stimulation with sodium phenylbutyrate (NaPB), a butyrate analogue and histone deacetylase inhibitor. ns5a-bax-2 1533955 n/a 1533956 unspecified role unspecified role bait bait bh2_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533957 unspecified role unspecified role prey prey human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). physical association physical association false false false 6A Interaction happens in response to stimulation with sodium phenylbutyrate (NaPB), a butyrate analogue and histone deacetylase inhibitor.