HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html zech-2003-5 Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com J. Gen. Virol. (0022-1317) 2003 imex curation Only protein-protein interactions imex curation zech-2003-1 Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com J. Gen. Virol. (0022-1317) 2003 imex curation Only protein-protein interactions imex curation zech-2003-2 Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com J. Gen. Virol. (0022-1317) 2003 imex curation Only protein-protein interactions imex curation zech-2003-3 Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com J. Gen. Virol. (0022-1317) 2003 imex curation Only protein-protein interactions imex curation zech-2003-4 Identification and characterization of amphiphysin II as a novel cellular interaction partner of the hepatitis C virus NS5A protein. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Zech B., Kurtenbach A., Krieger N., Strand D., Blencke S., Morbitzer M., Salassidis K., Cotten M., Wissing J., Obert S., Bartenschlager R., Herget T., Daub H. Virus - Publications including interactions involving viral proteins daub@axxima.com J. Gen. Virol. (0022-1317) 2003 imex curation Only protein-protein interactions imex curation o00499-7 Myc box-dependent-interacting protein 1 BIN1 AMPHL Amphiphysin II Amphiphysin-like protein Box-dependent myc-interacting protein 1 Bridging integrator 1 protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP bin1_human Myc box-dependent-interacting protein 1 Bridging integrator 1 Amphiphysin-like protein Box-dependent myc-interacting protein 1 BIN1 AMPHL Amphiphysin II protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP p27958-pro_0000037576 Non-structural protein 5A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SGSWLRDIWDWICEVLSDFKTWLKAKLMPQLPGIPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTTGPCTPLPAPNYKFALWRVSAEEYVEIRRVGDFHYVSGMTTDNLKCPCQIPSPEFFTELDGVRLHRFAPPCKPLLREEVSFRVGLHEYPVGSQLPCEPEPDVAVLTSMLTDPSHITAEAAGRRLARGSPPSMASSSASQLSAPSLKATCTANHDSPDAELIEANLLWRQEMGGNITRVESENKVVILDSFDPLVAEEDEREVSVPAEILRKSRRFAPALPVWARPDYNPLLVETWKKPDYEPPVVHGCPLPPPRSPPVPPPRKKRTVVLTESTLPTALAELATKSFGSSSTSGITGDNTTTSSEPAPSGCPPDSDVESYSSMPPLEGEPGDPDLSDGSWSTVSSGADTEDVVCC 1973 2420 o00499-6 Myc box-dependent-interacting protein 1 BIN1 AMPHL Amphiphysin II Amphiphysin-like protein Box-dependent myc-interacting protein 1 Bridging integrator 1 protein protein human Homo sapiens Human MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP ns5a-amphiphysin2_sh3-1 1457166 n/a 1457171 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma n/a 1457172 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma n/a NS5A 1457173 unspecified role unspecified role bait bait P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1c ns5a-amphiphysin2-2_short-1 1457166 n/a 1457171 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma n/a NS5A 1457173 unspecified role unspecified role bait bait P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1c ns5a-amphiphysin2-2 1457166 n/a 1457174 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma n/a NS5A 1457173 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1c ns5a-amphiphysin2-3 1457167 n/a 1457172 unspecified role unspecified role prey prey 33p 33p radiolabel 33p radiolabel P33 33P certain certain sequence position certain certain certain sequence position certain false human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma n/a NS5A 1457173 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1a ns5a-amphiphysin2-1 1457168 n/a NS5A 1457173 unspecified role unspecified role bait bait P27958-PRO_0000037576:p.Pro350Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro353Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037576:p.Pro354Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1457172 unspecified role unspecified role prey prey human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma physical association physical association false false false Fig. 1b p27958_pro-bin1-1 1457169 n/a NS5A 1457173 unspecified role unspecified role bait bait n/a 1457172 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2a bin1-p27958_pro-1 1457170 n/a 1457172 unspecified role unspecified role neutral component neutral component fitc fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS5A 1457173 unspecified role unspecified role neutral component neutral component cy3 label cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2b