MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint foucault-2003-1 The chaperone protein 14-3-3 interacts with 3BP2/SH3BP2 and regulates its adapter function. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Foucault I., Liu YC., Bernard A., Deckert M. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2003 rapid curation foucault-2003-2 The chaperone protein 14-3-3 interacts with 3BP2/SH3BP2 and regulates its adapter function. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Foucault I., Liu YC., Bernard A., Deckert M. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2003 rapid curation foucault-2003-3 The chaperone protein 14-3-3 interacts with 3BP2/SH3BP2 and regulates its adapter function. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Foucault I., Liu YC., Bernard A., Deckert M. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2003 rapid curation foucault-2003-4 The chaperone protein 14-3-3 interacts with 3BP2/SH3BP2 and regulates its adapter function. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Foucault I., Liu YC., Bernard A., Deckert M. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2003 rapid curation foucault-2003-5 The chaperone protein 14-3-3 interacts with 3BP2/SH3BP2 and regulates its adapter function. unknown Unknown pull down pull down predetermined predetermined participant predetermined Foucault I., Liu YC., Bernard A., Deckert M. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2003 rapid curation 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN 3bp2_human SH3 domain-binding protein 2 SH3BP2 3BP2 RES4-23 protein protein human Homo sapiens Human MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMALLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR ywhaq-sh3bp2 11455 1433t_human 1433T 11460 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 3bp2_human 3BP2 11461 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false 2H identifies 14-3-3 zheta, epsilon and TAU ( Tau is more expressed in lymphoid tissues)rn- CoIP overexpressing Myc-3BP2 and HA-14-3-3 TAU in COSrn- In vitro pull down with GST-14-3-3 TAUrn- CoIP with endogenous level 3BP2, western with anti 14-3-3 reveals ( in resting mocytic U937 cells)rn- In COS-1 myc-3BP2 and HA-14-3-3 TAU are colocalized with double immunofluorescence and cofocal microscopy ( cytoplasm):rnmapping of interactive serines in two-hybrid: s225A binds poorly, S277A abolishes bindingrn- GST-14-3-3 pull down with 3BP1 mutated in ser225ala ( perturbed binding) or ser277ala ( abolished)rn homomint domino mint sh3bp2-ywhaq 11455 3bp2_human 3BP2 11461 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false PR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433t_human 1433T 11460 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Phosphorylation of 3BP2 by ser/thr kinases, like PKC,permits recruiment of 14-3-3 dimers, wich in turn leads to down modulation of 3BP2 dependent gene activation. homomint domino mint ywhaq-sh3bp2-1 11456 1433t_human 1433T 11460 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 3bp2_human 3BP2 11461 unspecified role unspecified role prey prey purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false 2H identifies 14-3-3 zheta, epsilon and TAU ( Tau is more expressed in lymphoid tissues)rn- CoIP overexpressing Myc-3BP2 and HA-14-3-3 TAU in COSrn- In vitro pull down with GST-14-3-3 TAUrn- CoIP with endogenous level 3BP2, western with anti 14-3-3 reveals ( in resting mocytic U937 cells)rn- In COS-1 myc-3BP2 and HA-14-3-3 TAU are colocalized with double immunofluorescence and cofocal microscopy ( cytoplasm):rnmapping of interactive serines in two-hybrid: s225A binds poorly, S277A abolishes bindingrn- GST-14-3-3 pull down with 3BP1 mutated in ser225ala ( perturbed binding) or ser277ala ( abolished)rn homomint domino mint sh3bp2-ywhaq-1 11456 3bp2_human 3BP2 11461 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false PR phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433t_human 1433T 11460 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false Phosphorylation of 3BP2 by ser/thr kinases, like PKC,permits recruiment of 14-3-3 dimers, wich in turn leads to down modulation of 3BP2 dependent gene activation. homomint domino mint sh3bp2-ywhaq-2 11457 3bp2_human 3BP2 11461 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false PR phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433t_human 1433T 11460 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Phosphorylation of 3BP2 by ser/thr kinases, like PKC,permits recruiment of 14-3-3 dimers, wich in turn leads to down modulation of 3BP2 dependent gene activation. homomint domino mint sh3bp2-ywhaq-3 11458 3bp2_human 3BP2 11461 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 1433t_human 1433T 11460 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization false false false F2D homomint domino mint sh3bp2-ywhaq-4 11459 3bp2_human 3BP2_HUMAN 11461 unspecified role unspecified role unspecified role unspecified role 1433t_human 1433T_HUMAN 11460 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint