UniProt UniProt http://www.uniprot.org priet-2003-1 Functional role of HIV-1 virion-associated uracil DNA glycosylase 2 in the correction of G:U mispairs to G:C pairs. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Priet S., Navarro J.M., Gros N., Querat G., Sire J. Virus - Publications including interactions involving viral proteins HIV-1 integrase IN has been mapped to the UniProt HIV-1 virus reference strain. jsire@inserm-u372.univ-mrs.fr J. Biol. Chem. (0021-9258) 2003 imex curation HIV-1 AD8 strain has been used (NCBI AF004394); its integrase is not annotated in UniProt yet (UniProt AC O40216) and coordinates have been established according UniProt reference strain (UniProt AC P04585). Origin of UNG2/UNG according ref 21 (pubmed 7819187 citing pubmed 2555154). Exp including viral reverse transcriptase RT (fig 5) not included as proteins cannot be mapped to UniProt; supporting references have been deleted from the publication (ref 24, ref 29) Only protein-protein interactions p04585-pro_0000042447 Integrase gag-pol Pr160Gag-Pol protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 1148 1435 p13051-1 Uracil-DNA glycosylase UNG2 UNG DGU UNG1 UNG15 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL gag_pol-pol 1778538 n/a 1778539 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P04585-PRO_0000042447:p.Leu172_Lys173delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P04585-PRO_0000042447:p.Leu172Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1778540 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1