MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint sato-2002-1 Regulation of kinase activity of 3-phosphoinositide-dependent protein kinase-1 by binding to 14-3-3. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Sato S., Fujita N., Tsuruo T. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 sato-2002-2 Regulation of kinase activity of 3-phosphoinositide-dependent protein kinase-1 by binding to 14-3-3. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sato S., Fujita N., Tsuruo T. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN pdpk1_human 3-phosphoinositide-dependent protein kinase 1 PDPK1 PDK1 protein protein human Homo sapiens Human MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN ywhaq-pdpk1 11387 1433t_human 11389 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 pdpk1_human 11390 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false Co-IP 14-3-3-HA (pCRII vector Invitrogen) with PDK1-Myc (PCMV3 vector). Theta binds more tightlyrnC0-IP Endogenous: 14-3-3 Theta co-precipitates a fainth bando f PRK1 visible with anti PDK1. In 293T and NIH3T3rnGST pull down: GST-14-3-3 theta pulls down Myc- PDK1 and Raf from COS-7 lysatesrnCo-IP HA-14-3-3 theta with Flag-PDK1, if 14-3-3 is murarted R127A, less PDK1 is co-immunoprecipitated. 14-3-3 theta R56A,R60A binds as wt.rnCo-IP Flag-PDK1 with 14-3-3-HA is abolished if PDK1 has S241A: 238RANS241 or R238E. Binding increases if V243P (classical binding motif0.rnThe PRK1 site RSGS410 does not bind even if it is phosphorylated in vivo.rn homomint mint ywhaq-pdpk1-1 11387 1433t_human 11389 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 pdpk1_human 11390 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false Co-IP 14-3-3-HA (pCRII vector Invitrogen) with PDK1-Myc (PCMV3 vector). Theta binds more tightlyrnC0-IP Endogenous: 14-3-3 Theta co-precipitates a fainth bando f PRK1 visible with anti PDK1. In 293T and NIH3T3rnGST pull down: GST-14-3-3 theta pulls down Myc- PDK1 and Raf from COS-7 lysatesrnCo-IP HA-14-3-3 theta with Flag-PDK1, if 14-3-3 is murarted R127A, less PDK1 is co-immunoprecipitated. 14-3-3 theta R56A,R60A binds as wt.rnCo-IP Flag-PDK1 with 14-3-3-HA is abolished if PDK1 has S241A: 238RANS241 or R238E. Binding increases if V243P (classical binding motif0.rnThe PRK1 site RSGS410 does not bind even if it is phosphorylated in vivo.rn homomint mint ywhah-pdpk1 11387 pdpk1_human 11390 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 1433f_human 11391 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint ywhaq-pdpk1-2 11388 1433t_human 11389 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 pdpk1_human 11390 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false Co-IP 14-3-3-HA (pCRII vector Invitrogen) with PDK1-Myc (PCMV3 vector). Theta binds more tightlyrnC0-IP Endogenous: 14-3-3 Theta co-precipitates a fainth bando f PRK1 visible with anti PDK1. In 293T and NIH3T3rnGST pull down: GST-14-3-3 theta pulls down Myc- PDK1 and Raf from COS-7 lysatesrnCo-IP HA-14-3-3 theta with Flag-PDK1, if 14-3-3 is murarted R127A, less PDK1 is co-immunoprecipitated. 14-3-3 theta R56A,R60A binds as wt.rnCo-IP Flag-PDK1 with 14-3-3-HA is abolished if PDK1 has S241A: 238RANS241 or R238E. Binding increases if V243P (classical binding motif0.rnThe PRK1 site RSGS410 does not bind even if it is phosphorylated in vivo.rn homomint mint