MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint urano-2002-1 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins Nature (0028-0836) 2002 urano-2002-2 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. in vivo in vivo experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins Nature (0028-0836) 2002 urano-2002-3 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Urano T., Saito T., Tsukui T., Fujita M., Hosoi T., Muramatsu M., Ouchi Y., Inoue S. Virus - Publications including interactions involving viral proteins Nature (0028-0836) 2002 tri25_mouse E3 ubiquitin/ISG15 ligase TRIM25 RING-type E3 ubiquitin transferase TRIM25 Trim25 Efp Zfp147 Znf147 Zinc finger protein 147 Estrogen-responsive finger protein Ubiquitin/ISG15-conjugating enzyme TRIM25 Tripartite motif-containing protein 25 RING-type E3 ubiquitin transferase protein protein mouse Mus musculus Mouse MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCMSCLDETWVVQGPPYRCPQCRKVYQVRPQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQVACDHCLTEIAVKTCLVCMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLRELFCPEHGECICHICLVEHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDVRSKQQCVQDSMKRKMEQLRQEYMEMKAVIDAAETSSLRKLKEEEKRVYGKFDTIYQVLVKKKSEMQKLKAEVELIMDKGDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGAADLKSELKHSIKKLQKKSEEHNGSGNKGDQTQSTFKPVQPSKKTIQEKKTKKTPVAPGPPSHFSPNKLPTFGAPGQSLDSKATSPDAAPKASAAQPDSVGVKAKVLENFLTKSRTELLEYFVKVIFDYNTAHNKVSLSNKYTTASVSDGLQHYRSHPQRFTYCSQVLGLHCYKNGIHYWEVELQKNNFCGVGICYGSMERQGPESRLGRNPNSWCVEWFNNKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVTEKVHLMYKFKVDFTEALYPAFWVFSAGTTLSICSK mint Mediates estrogen action in various target organs 1433s_mouse 14-3-3 protein sigma Sfn Mkrn3 Stratifin protein protein mouse Mus musculus Mouse MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVKEYREKVETELRGVCDTVLGLLDSHLIKGAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADSAGEEGGEAPEEPQS ub2l6_human Ubiquitin/ISG15-conjugating enzyme E2 L6 UBE2L6 UBCH8 Ubiquitin-protein ligase L6 Ubiquitin carrier protein L6 UbcH8 Retinoic acid-induced gene B protein E2 ubiquitin-conjugating enzyme L6 protein protein human Homo sapiens Human MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS trim25-sfn 10156 tri25_mouse 10159 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false COILED COIL REGION Stoichiometry: 1.0 1433s_mouse 10160 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint domino mint trim25-ube2l6 10156 tri25_mouse 10159 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 ub2l6_human 10161 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint domino mint sfn-trim25 10157 tri25_mouse 10159 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 1433s_mouse 10160 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 ubiquitination ubiquitination reaction ubiquitination false false false homomint domino mint sfn-trim25-1 10158 tri25_mouse Efp 10159 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false COILED COIL REGION Stoichiometry: 1.0 1433s_mouse 10160 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization false false false F3A homomint domino mint